Potri.003G073450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G073450.1 pacid=42784945 polypeptide=Potri.003G073450.1.p locus=Potri.003G073450 ID=Potri.003G073450.1.v4.1 annot-version=v4.1
ATGACCGGTTGGTGGCCGGTGACTCAAGAGATTGGTTTTGGAGTTTGCAGCGAGGAGCATGATGAGCTGCTCATGATAAGGAGTCTGAGGCTAATGACAG
CAAAGGCACCCAACGGAGCTGCTGTCATTGAAACCATCAATAGGGAAGAAGCGGAGGAGATAGCTAAAGGGGAGGAGGAAGGGAAAAGGTGGAGAAAATT
GTGA
AA sequence
>Potri.003G073450.1 pacid=42784945 polypeptide=Potri.003G073450.1.p locus=Potri.003G073450 ID=Potri.003G073450.1.v4.1 annot-version=v4.1
MTGWWPVTQEIGFGVCSEEHDELLMIRSLRLMTAKAPNGAAVIETINREEAEEIAKGEEEGKRWRKL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G073450 0 1
Potri.005G031948 8.30 0.9571
AT5G05800 unknown protein Potri.010G045701 12.68 0.9571
Potri.002G132850 13.56 0.9516
Potri.004G075950 16.61 0.9446
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Potri.001G308050 17.43 0.9247
AT4G11850 PLDGAMMA1, MEE5... maternal effect embryo arrest ... Potri.004G218900 18.33 0.9190
AT5G41700 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN... Potri.013G158600 19.51 0.7398
Potri.019G014330 20.97 0.9448
Potri.008G069050 26.40 0.9380
AT5G14345 AtENODL21 early nodulin-like protein 21 ... Potri.015G113300 27.27 0.6744

Potri.003G073450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.