Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53708 80 / 2e-21 RTFL9 ROTUNDIFOLIA like 9 (.1) AT3G14362 74 / 8e-20 DVL19, RTFL10 DEVIL 19, ROTUNDIFOLIA like 10 (.1) AT3G55515 56 / 2e-12 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G39705 52 / 1e-10 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT2G36985 49 / 5e-10 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) AT2G29125 49 / 5e-09 RTFL2, DVL13 DEVIL 13, ROTUNDIFOLIA like 2 (.1) AT4G13395 47 / 6e-09 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT1G17235 46 / 3e-08 RTFL11 ROTUNDIFOLIA like 11 (.1) AT5G59510 46 / 8e-08 RTFL5, DVL18 DEVIL 18, ROTUNDIFOLIA like 5 (.1) AT1G13245 44 / 9e-08 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G161200 [exp] 113 / 3e-35 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.002G235101 [exp] 84 / 8e-24 AT1G53708 75 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.001G242800 [exp] 56 / 3e-12 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.008G057800 [exp] 56 / 5e-12 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.010G201700 [exp] 55 / 6e-12 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.010G226250 [exp] 54 / 6e-12 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G035900 [exp] 54 / 6e-12 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G116700 [exp] 45 / 3e-08 AT1G13245 76 / 6e-21 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.006G125600 [exp] 45 / 3e-08 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021966 [exp] 82 / 6e-23 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1) Lus10041259 [exp] 80 / 4e-22 AT1G53708 70 / 2e-17 ROTUNDIFOLIA like 9 (.1) Lus10002705 [exp] 56 / 4e-12 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10023399 [exp] 54 / 3e-11 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 52 / 2e-10 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10001569 [exp] 47 / 1e-08 AT5G59510 79 / 8e-20 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10034272 [exp] 45 / 3e-08 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 44 / 1e-07 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10026526 [exp] 43 / 3e-07 AT2G36985 63 / 2e-15 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Lus10028393 [exp] 42 / 4e-07 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.003G073900.1 pacid=42786604 polypeptide=Potri.003G073900.1.p locus=Potri.003G073900 ID=Potri.003G073900.1.v4.1 annot-version=v4.1 ATGGCTGAGATTAAGTTACAAGTATACAACAAGAGCAGTGGGGCCAAAAAGGCCCCTGCTACAAGGAGATCCAAGGGGCATGGCTTCACCAACAAGTGTG CAGCCCTGGTCAAGGAGCAACGTGCTCGTATCTACATCCTACGCCGTTGCGCCACCATGCTTCTTTGCTGGTATATTCAGGGTGATGATTAG
AA sequence Show only first row Show all	>Potri.003G073900.1 pacid=42786604 polypeptide=Potri.003G073900.1.p locus=Potri.003G073900 ID=Potri.003G073900.1.v4.1 annot-version=v4.1 MAEIKLQVYNKSSGAKKAPATRRSKGHGFTNKCAALVKEQRARIYILRRCATMLLCWYIQGDD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Potri.003G073900 [exp]	0	1
AT1G63410			Protein of unknown function (D...		Potri.001G106400 [exp]	3.00	0.9499
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Potri.001G161200 [exp]	3.46	0.9444
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.001G312600 [exp]	4.00	0.9543
AT2G38870			Serine protease inhibitor, pot...		Potri.006G212000 [exp]	4.58	0.9401
AT1G78780			pathogenesis-related family pr...		Potri.001G389800 [exp]	4.89	0.9395
AT1G11925			Stigma-specific Stig1 family p...		Potri.008G220900 [exp]	4.89	0.9451
AT1G29520			AWPM-19-like family protein (....		Potri.001G354500 [exp]	5.47	0.9187
AT4G17340		TIP2;2, DELTA-T...	tonoplast intrinsic protein 2;...		Potri.003G077800 [exp]	9.53	0.9251	Pt-TIP2.5
AT2G19800		MIOX2	myo-inositol oxygenase 2 (.1)		Potri.017G100200 [exp]	9.89	0.9248
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Potri.016G073900 [exp]	10.39	0.9330	CTS2.13

Compare expression of checked genes

Potri.003G073900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.