Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20030 164 / 1e-52 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 70 / 4e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G20930 73 / 2e-15 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G19030 69 / 6e-15 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT5G06210 62 / 2e-12 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G73530 62 / 2e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 61 / 4e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G08000 59 / 2e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G10400 60 / 4e-11 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT2G37510 56 / 4e-10 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G022280 [exp] 76 / 8e-18 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 74 / 1e-16 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 72 / 2e-16 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022200 [exp] 75 / 3e-16 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 74 / 5e-16 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G227500 [exp] 72 / 2e-15 AT3G10400 223 / 7e-73 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.001G409800 [exp] 66 / 4e-14 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G160300 [exp] 63 / 2e-13 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 62 / 2e-12 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006936 [exp] 142 / 1e-43 AT4G20030 137 / 4e-42 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10037960 [exp] 73 / 5e-16 AT3G10400 240 / 2e-79 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Lus10027035 [exp] 74 / 8e-16 AT3G20930 360 / 8e-123 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10038693 [exp] 68 / 5e-14 AT3G10400 244 / 6e-81 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Lus10029426 [exp] 66 / 4e-13 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10003593 [exp] 64 / 3e-12 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 64 / 3e-12 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10018277 [exp] 64 / 3e-12 AT4G19610 770 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1) Lus10025573 [exp] 64 / 4e-12 AT3G20930 336 / 3e-109 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10040854 [exp] 59 / 5e-12 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.003G074900.1 pacid=42785750 polypeptide=Potri.003G074900.1.p locus=Potri.003G074900 ID=Potri.003G074900.1.v4.1 annot-version=v4.1 ATGGAGGTAATGATGATGATGATGTCTCAAACAAGACCGCTTTCAACTGTCTCTATCCCCATACCCTCGTTGGCAAACGCAATATCTCAAAGAAATTTCA AGAACCCAAAAACTTTGAAACTCAGGGCATCAATTTCCAACCCCAATTTTCCTCTTGCAAGCAGAATTATGGTTACAAATATAGGACATTCTATCAGTGA AGCTACTTTGCAAAAGGAATTTTCAAATTTTGGTGAAATAGCTGAAGTGAAGCTTGTGAAGGATGAAACCATTAAAAGGTCCAAACCATATGCATTTATT CAATACACTTCTCAGGATGATGCCATCCTTGCCCTGGAAAATATGGACCGTAAGACTCTTGATGGCAGGTTAATTTTTGTTGATCTTGCCAAACCTGGGA AAGACCGGTTTAGAGGATACATGAAAACTTGTGGACCTCCAAAGAAGCAGCAGGTGCAGGACACGCAAGATGAGGTTGCAGATTGCTGGTACTGA
AA sequence Show only first row Show all	>Potri.003G074900.1 pacid=42785750 polypeptide=Potri.003G074900.1.p locus=Potri.003G074900 ID=Potri.003G074900.1.v4.1 annot-version=v4.1 MEVMMMMMSQTRPLSTVSIPIPSLANAISQRNFKNPKTLKLRASISNPNFPLASRIMVTNIGHSISEATLQKEFSNFGEIAEVKLVKDETIKRSKPYAFI QYTSQDDAILALENMDRKTLDGRLIFVDLAKPGKDRFRGYMKTCGPPKKQQVQDTQDEVADCWY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G20030			RNA-binding (RRM/RBD/RNP motif...		Potri.003G074900 [exp]	0	1
AT5G03370			acylphosphatase family (.1)		Potri.016G093000 [exp]	2.82	0.9571
					Potri.019G045600 [exp]	3.46	0.9502
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Potri.012G115800 [exp]	3.46	0.9600
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Potri.018G063901 [exp]	3.87	0.9544
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Potri.009G159800 [exp]	6.24	0.9397
AT1G34420			leucine-rich repeat transmembr...		Potri.019G084700 [exp]	8.48	0.9102
AT3G56330			N2,N2-dimethylguanosine tRNA m...		Potri.013G093500 [exp]	10.19	0.9453
AT2G20000		CDC27b, HBT	HOBBIT, CDC27 family protein ...		Potri.017G065600 [exp]	10.48	0.9405
AT5G27280			Zim17-type zinc finger protein...		Potri.005G246200 [exp]	10.58	0.9495
AT4G29260			HAD superfamily, subfamily III...		Potri.006G152900 [exp]	10.95	0.8980

Compare expression of checked genes

Potri.003G074900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.