Potri.003G075800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22160 54 / 8e-09 VQ motif-containing protein (.1)
AT4G39720 50 / 4e-07 VQ motif-containing protein (.1)
AT4G15120 47 / 2e-06 VQ motif-containing protein (.1)
AT1G35830 47 / 4e-06 VQ motif-containing protein (.1)
AT5G65170 45 / 2e-05 VQ motif-containing protein (.1)
AT4G20000 44 / 2e-05 VQ motif-containing protein (.1)
AT2G41010 41 / 0.0004 ATCAMBP25 calmodulin (CAM)-binding protein of 25 kDa (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158800 298 / 4e-103 AT4G39720 58 / 6e-10 VQ motif-containing protein (.1)
Potri.006G006300 57 / 1e-09 AT4G39720 49 / 2e-06 VQ motif-containing protein (.1)
Potri.005G166100 50 / 3e-07 AT5G65170 94 / 8e-21 VQ motif-containing protein (.1)
Potri.005G076600 48 / 2e-06 AT5G65170 70 / 7e-13 VQ motif-containing protein (.1)
Potri.016G017900 47 / 3e-06 AT4G15120 / VQ motif-containing protein (.1)
Potri.002G094900 45 / 3e-05 AT1G35830 89 / 1e-19 VQ motif-containing protein (.1)
Potri.007G091600 44 / 5e-05 AT5G65170 72 / 2e-13 VQ motif-containing protein (.1)
Potri.016G029600 41 / 0.0002 AT3G56880 125 / 4e-35 VQ motif-containing protein (.1)
Potri.006G032300 41 / 0.0002 AT3G56880 127 / 1e-35 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016814 67 / 2e-13 AT4G39720 52 / 4e-08 VQ motif-containing protein (.1)
Lus10024738 49 / 1e-06 AT1G35830 92 / 3e-21 VQ motif-containing protein (.1)
Lus10006941 49 / 1e-06 AT1G35830 93 / 3e-21 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.003G075800.1 pacid=42786931 polypeptide=Potri.003G075800.1.p locus=Potri.003G075800 ID=Potri.003G075800.1.v4.1 annot-version=v4.1
ATGAGTGACACTATGGCTAGTCAGTCGAGTGATTGGGTGCAACTCTATCAACAGGGCAGCATTCATGGACAGGCAACATCTTCCTTTGTATTCTCGGATG
CCACCATTGTTAATGTAACAAGTGGTGCATCTGATAATATCATAAATCCAAACAGCTCATCGATTACATCAAGTACTGGTGATCAGAGGTTGACCCCTCA
AGGTTGTGTGTCGAAGCCAGTCACAAGGAGGTCTAGAGCTTCAAAGAAGACGCCAGCAACCCTCATCAATGCCAGCACTGCTAATTTTAGAGCCTTAGTG
CAACAATTCACTGGCTGTCCTCCTAGTACCTCAATTTCATTTGGGAGCCACAAGGGCCCGATCAACTTGAATTTTGGACTCGGAAGTGCACAAAACCATA
GCTGTGCTACTGCAGAAACGGAGCCTCTTGGCAACAGCTATTATCATAGACGACTATCTCAGATGCAGCAACCGAGGCAAAATGCACAGCAACTGCACCA
GGACCAAGGATGCAATGTTTCACTTGATAATCTTCCTAATAGCAATGGTTACTCCTCGGTTTCTAGTGACCTTGGACCACATTTAGAGATGCCAGCTGAT
TATGGGCTTTTCAATATGGACGATATTGCTCTGCAAGAGCTTGTTAACGAGTCTTTCTCCGATGAAAACATGAACAATATCGATTGCTTTTAG
AA sequence
>Potri.003G075800.1 pacid=42786931 polypeptide=Potri.003G075800.1.p locus=Potri.003G075800 ID=Potri.003G075800.1.v4.1 annot-version=v4.1
MSDTMASQSSDWVQLYQQGSIHGQATSSFVFSDATIVNVTSGASDNIINPNSSSITSSTGDQRLTPQGCVSKPVTRRSRASKKTPATLINASTANFRALV
QQFTGCPPSTSISFGSHKGPINLNFGLGSAQNHSCATAETEPLGNSYYHRRLSQMQQPRQNAQQLHQDQGCNVSLDNLPNSNGYSSVSSDLGPHLEMPAD
YGLFNMDDIALQELVNESFSDENMNNIDCF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22160 VQ motif-containing protein (.... Potri.003G075800 0 1
Potri.014G059701 2.82 0.8938
AT1G19020 unknown protein Potri.012G075800 9.05 0.9037
Potri.008G212400 9.48 0.9040
AT2G45040 Matrixin family protein (.1) Potri.001G157500 12.36 0.9021 Pt-MMP.15
Potri.019G016104 13.85 0.8197
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Potri.019G003500 14.69 0.8859
AT1G68765 IDA INFLORESCENCE DEFICIENT IN ABS... Potri.010G131500 15.36 0.9016
AT2G42360 RING/U-box superfamily protein... Potri.019G091400 16.58 0.8984
AT3G22560 Acyl-CoA N-acyltransferases (N... Potri.008G154800 17.32 0.8557
AT1G07530 GRAS SCL14, ATGRAS2 GRAS \(GAI, RGA, SCR\) 2, ARAB... Potri.009G032800 25.07 0.8661

Potri.003G075800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.