Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16566 210 / 4e-71 HINT4 histidine triad nucleotide-binding 4 (.1) AT3G56490 42 / 2e-05 HIT3, HINT1 HISTIDINE TRIAD NUCLEOTIDE-BINDING 1, HIS triad family protein 3 (.1) AT5G48545 40 / 0.0002 HINT3 histidine triad nucleotide-binding 3 (.1) AT1G31160 39 / 0.0005 HINT2 ,HINT 2 HISTIDINE TRIAD NUCLEOTIDE-BINDING 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G023700 [exp] 44 / 6e-06 AT3G56490 217 / 2e-73 HISTIDINE TRIAD NUCLEOTIDE-BINDING 1, HIS triad family protein 3 (.1) Potri.015G124700 [exp] 44 / 9e-06 AT1G31160 224 / 1e-75 HISTIDINE TRIAD NUCLEOTIDE-BINDING 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028941 [exp] 178 / 5e-54 AT4G16563 489 / 2e-169 Eukaryotic aspartyl protease family protein (.1) Lus10007467 [exp] 63 / 9e-14 AT4G16566 53 / 4e-10 histidine triad nucleotide-binding 4 (.1) Lus10035409 [exp] 49 / 8e-08 AT3G56490 224 / 1e-76 HISTIDINE TRIAD NUCLEOTIDE-BINDING 1, HIS triad family protein 3 (.1) Lus10031011 [exp] 42 / 2e-05 AT3G56490 228 / 2e-78 HISTIDINE TRIAD NUCLEOTIDE-BINDING 1, HIS triad family protein 3 (.1) Lus10036217 [exp] 40 / 0.0002 AT2G35110 2277 / 0.0 NCK-ASSOCIATED PROTEIN 1, GNARLED, transcription activators (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0265 [poplar] [flax] HIT PF11969 [poplar] [flax] DcpS_C Scavenger mRNA decapping enzyme C-term binding
Representative CDS sequence Show only first row Show all	>Potri.003G076400.1 pacid=42787221 polypeptide=Potri.003G076400.1.p locus=Potri.003G076400 ID=Potri.003G076400.1.v4.1 annot-version=v4.1 ATGGAGGGAGCGACCTCATCATGTATCTTCTGCCAGATTGCCACCAAATCCAGTTCCACTACTCTCCTTCACTCTGATGACAAGGTGGTCGCGTTTCAAG ATATCAACCCTTCTGCTTTCAGGCATTTCTTGGTGATTCCTGTGGAGCACATTCCAACTGTCAATGATCTCCAGAAGAGAGATGAAGATTATTCTTTGGT AAATCACATGTTGAATGTGGGGAAAACACTACTACACCTAGATGCACCTCAGTCAAAGCAGTACAGATTTGGCTTTCATCAGCCTCCATTTAACAGTGTT GACCATCTACACCTCCATTGTTTGGCATTACCTTTCATACCCAAATGGAAACATGTAAAATACATGTCTTTAGGACACCATGGATTTATTGAAGCTGAGC AGCTGCTGGAGAAAATAAAGCCTTCACAAGCATTCACTCCTTAG
AA sequence Show only first row Show all	>Potri.003G076400.1 pacid=42787221 polypeptide=Potri.003G076400.1.p locus=Potri.003G076400 ID=Potri.003G076400.1.v4.1 annot-version=v4.1 MEGATSSCIFCQIATKSSSTTLLHSDDKVVAFQDINPSAFRHFLVIPVEHIPTVNDLQKRDEDYSLVNHMLNVGKTLLHLDAPQSKQYRFGFHQPPFNSV DHLHLHCLALPFIPKWKHVKYMSLGHHGFIEAEQLLEKIKPSQAFTP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16566		HINT4	histidine triad nucleotide-bin...		Potri.003G076400 [exp]	0	1
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Potri.001G211600 [exp]	2.82	0.8768
AT1G26670		VTI1B, ATVTI12,...	VESICAL TRANSPORT V-SNARE 12, ...		Potri.010G164300 [exp]	3.87	0.8656	VTI12.2
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Potri.012G138500 [exp]	4.79	0.8972
AT3G50845			Protein of unknown function (D...		Potri.005G123100 [exp]	12.04	0.8278
AT2G44360			unknown protein		Potri.001G230100 [exp]	15.96	0.8392
AT5G49540			Rab5-interacting family protei...		Potri.010G148600 [exp]	18.11	0.8562
AT3G52560		MMZ4 ,UEV1D ,UE...	MMS2 ZWEI HOMOLOGUE 4, ubiquit...		Potri.016G073100 [exp]	20.39	0.8460
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Potri.005G235300 [exp]	27.38	0.8559
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Potri.008G040300 [exp]	29.12	0.8494	Pt-VMA10.1
AT4G34270			TIP41-like family protein (.1)		Potri.001G298500 [exp]	32.03	0.8219

Compare expression of checked genes

Potri.003G076400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.