Potri.003G076800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16600 633 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT2G35710 627 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
AT5G18480 121 / 2e-29 PGSIP6 plant glycogenin-like starch initiation protein 6 (.1)
AT1G08990 78 / 5e-15 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1)
AT1G54940 70 / 2e-12 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1)
AT4G33330 65 / 7e-11 PGSIP3, GUX2 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
AT1G77130 62 / 3e-10 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
AT3G18660 61 / 1e-09 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT2G47180 51 / 9e-07 ATGOLS1 galactinol synthase 1 (.1)
AT1G09350 50 / 1e-06 ATGOLS3 galactinol synthase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158000 812 / 0 AT4G16600 678 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.013G049100 114 / 5e-27 AT5G18480 661 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Potri.014G029900 67 / 1e-11 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Potri.005G033500 67 / 2e-11 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.005G187900 66 / 3e-11 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Potri.007G107200 64 / 1e-10 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.005G061600 64 / 2e-10 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.013G022900 62 / 6e-10 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.014G116800 58 / 6e-09 AT2G47180 568 / 0.0 galactinol synthase 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004717 671 / 0 AT4G16600 673 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Lus10008518 632 / 0 AT2G35710 632 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
Lus10027949 119 / 5e-29 AT5G18480 635 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Lus10000817 96 / 1e-22 AT5G18480 329 / 2e-111 plant glycogenin-like starch initiation protein 6 (.1)
Lus10021731 69 / 3e-12 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10018922 67 / 1e-11 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10028623 67 / 1e-11 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10042658 67 / 1e-11 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10031507 64 / 2e-10 AT1G54940 542 / 0.0 plant glycogenin-like starch initiation protein 4 (.1)
Lus10033485 64 / 2e-10 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
PFAM info
Representative CDS sequence
>Potri.003G076800.1 pacid=42785275 polypeptide=Potri.003G076800.1.p locus=Potri.003G076800 ID=Potri.003G076800.1.v4.1 annot-version=v4.1
ATGGCTTCTTCTCGAGAGCCTTGGTTAATGTTGAGGTTTCTGTTGCTTTTAGTTCTCGCTGTATATAAAACGACAGCGTTTGGAGTGGTCGTGAAGGCTG
GCCAGATAGAGCAGCAGCAACAGCTCCAGCAGGAAGGTCCACCGCAACGGCACAAAAACGCATACGCGACGATGATGTACATGGGGACACCAAGAGACTA
CGAGTTCTACGTTGCTATACGGGTCATGCTCAGATCTCTCGCTAAATTACAAGTGGACGCTGATCTCGTCGTCATTGCCTCCCACGATGTTCCTCACCGT
TGGGTTCATACCATGGAACAGGAAGATGGTGCAAGGGTAATGAGAGTGGAAAATGTGAACAATCCGTATAAGAACCAACCCAATTTTGATAGGAGATTTC
TATTAACATTGAACAAACTCTATGTATGGAAATTGGTGGAATATGAGAGGGTGGTCATGCTTGATGCTGACAATCTTTTCCTCAGAAAACCTGATGAGTT
GTTCCAATGTGGACAATTCTGTGCAGTCTTCATCAACCCCTGTATATTCCATACCGGCCTCTTTGTGTTACAGCCATCCATGGAAGTGTTTAACGACATG
CTTCATCAGTTGGAAATTGGGAAACATAACCCTGATGGTGCAGACCAAGGTTTTATTAGTAGCTACTTTCCTGACTTGCTTGATATGCCAATGTTCCATC
CACCTCTAAATGGCACCACAGTCAACGGGTCTTATAGACTTCCTTTAGGCTACCAAATGGAGGCCACTTATTACTATCTTAGACTCCGCTGGAATGTACC
CTGTGGGCCTAACAGCGTGATTACTTTCCCTGGTGCTCTGTGGTTGAAACCATGGTATTGGTGGTCATGGCCTGTTTTGCCATTGGGCATTCAATGGCAT
GAACAACGTCGTCAAAATATGGGATACGGAGCGGAGACGACCATGGCACTCATTCAGTGCATAGTTTTCGTAGGAATAATAGCAGTAACACGACTAGCGC
GGCCAAATATCTCCAAGCTTTGCTATCGGCGAACAGAAAAGAACATCTCCGCTATACAAGCCGGTCTTAAAATGTTAGCAATATGGTCGATTCTTGCAGC
CTATATACTCCCCATCATCATCATTCCTTGCACAATCCATCCATTATTAGGCTGGGGATTGTACTTGCTCGGTTCGTTTGCGCTTTGCACTATAGCGATC
AATGCATTTATGCTGCCGACGTTACCAGTTTTGACTCCATGTCTAGGGATATTTGGGGTCCTTTTGGTCATGGCATTTCCTTTATACTCGAATGGCATTA
TTAGAGCATTATCTATTTTTGGCTACGCATTCTGTGCTGCACCTTTTCTCTGGGTATCAGTGGTTAAGATCATGGCAAGCCTTCAAGCATCCCTTGAAAG
GGAAAATTTCTTCCCTAGATTGGGTGAATCTTCGCCGCCTTCTGGATTCAACAAGTTGTATTAG
AA sequence
>Potri.003G076800.1 pacid=42785275 polypeptide=Potri.003G076800.1.p locus=Potri.003G076800 ID=Potri.003G076800.1.v4.1 annot-version=v4.1
MASSREPWLMLRFLLLLVLAVYKTTAFGVVVKAGQIEQQQQLQQEGPPQRHKNAYATMMYMGTPRDYEFYVAIRVMLRSLAKLQVDADLVVIASHDVPHR
WVHTMEQEDGARVMRVENVNNPYKNQPNFDRRFLLTLNKLYVWKLVEYERVVMLDADNLFLRKPDELFQCGQFCAVFINPCIFHTGLFVLQPSMEVFNDM
LHQLEIGKHNPDGADQGFISSYFPDLLDMPMFHPPLNGTTVNGSYRLPLGYQMEATYYYLRLRWNVPCGPNSVITFPGALWLKPWYWWSWPVLPLGIQWH
EQRRQNMGYGAETTMALIQCIVFVGIIAVTRLARPNISKLCYRRTEKNISAIQAGLKMLAIWSILAAYILPIIIIPCTIHPLLGWGLYLLGSFALCTIAI
NAFMLPTLPVLTPCLGIFGVLLVMAFPLYSNGIIRALSIFGYAFCAAPFLWVSVVKIMASLQASLERENFFPRLGESSPPSGFNKLY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16600 Nucleotide-diphospho-sugar tra... Potri.003G076800 0 1
AT3G05290 AtPNC1, PNC1 peroxisomal adenine nucleotide... Potri.013G023200 10.95 0.9201
AT3G21790 UDP-Glycosyltransferase superf... Potri.016G016300 15.26 0.9277
AT3G58750 CSY2 citrate synthase 2 (.1) Potri.014G141900 18.16 0.8916
AT1G02070 unknown protein Potri.005G158400 18.30 0.9163
AT1G32690 unknown protein Potri.003G092700 18.97 0.9181
AT4G25800 Calmodulin-binding protein (.1... Potri.013G010700 26.68 0.9107
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Potri.019G003800 33.98 0.9089
AT5G47990 THAD1, THAD, CY... THALIAN-DIOL DESATURASE, "cyto... Potri.009G065000 34.98 0.9144 CYP705B5
AT1G78310 VQ motif-containing protein (.... Potri.005G162300 36.12 0.8850
AT1G64160 Disease resistance-responsive ... Potri.005G100700 49.06 0.8855

Potri.003G076800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.