Potri.003G078601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17380 102 / 1e-26 MSH4, ATMSH4 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G156200 107 / 5e-28 AT4G17380 1226 / 0.0 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007489 106 / 7e-28 AT4G17380 1205 / 0.0 ARABIDOPSIS MUTS HOMOLOG 4, MUTS-like protein 4 (.1)
PFAM info
Representative CDS sequence
>Potri.003G078601.1 pacid=42785626 polypeptide=Potri.003G078601.1.p locus=Potri.003G078601 ID=Potri.003G078601.1.v4.1 annot-version=v4.1
ATGATCCTGTGGTCGTCGTTGTTCCTCCTAATAAATATGCGCCTGATGGTTCTAATGGCCTGTGGTTGCTTTGATGACACCAAGGGTGCTGTACTGGTTA
AAAATCTAGCAGCCAAAGAGCCTTCAGCTCATGGTTTGGATGCTTACTACAAGCAATATTATCCCTGCTTGTCTGCTGCTGCAGCTACAATCAAGTGGAC
AGAAGCAGAGAAAGGAGTCATCGTCACCAACCACCCATTGTTGCTATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGGGGACCTTTCTTTCTCTT
GCGAAATGCATGTATCATTGTTCGTTAAGAATTTTTACATCAGTCCAACACGCTCATTTCTAA
AA sequence
>Potri.003G078601.1 pacid=42785626 polypeptide=Potri.003G078601.1.p locus=Potri.003G078601 ID=Potri.003G078601.1.v4.1 annot-version=v4.1
MILWSSLFLLINMRLMVLMACGCFDDTKGAVLVKNLAAKEPSAHGLDAYYKQYYPCLSAAAATIKWTEAEKGVIVTNHPLLLSLSLSLSLSLSLGTFLSL
AKCMYHCSLRIFTSVQHAHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G17380 MSH4, ATMSH4 ARABIDOPSIS MUTS HOMOLOG 4, M... Potri.003G078601 0 1
AT5G48570 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-... Potri.006G033400 6.92 0.7216
AT2G34090 MEE18 maternal effect embryo arrest ... Potri.011G065000 17.37 0.6193
AT3G14660 CYP72A13 "cytochrome P450, family 72, s... Potri.011G099200 20.17 0.6790
AT1G01200 ATRAB-A3, AtRAB... ARABIDOPSIS RAB GTPASE HOMOLOG... Potri.002G175700 42.70 0.6294
AT3G14630 CYP72A9 "cytochrome P450, family 72, s... Potri.011G099701 72.43 0.6184
AT3G57810 Cysteine proteinases superfami... Potri.016G050900 126.75 0.6284

Potri.003G078601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.