Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16770 358 / 3e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 328 / 2e-113 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G35190 258 / 1e-84 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 253 / 7e-83 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 212 / 2e-67 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 203 / 2e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G23340 122 / 3e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06640 115 / 2e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT2G38240 114 / 5e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G13610 112 / 3e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086800 [exp] 298 / 2e-100 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086900 [exp] 290 / 3e-97 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.007G047100 [exp] 126 / 7e-34 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.003G128100 [exp] 119 / 3e-31 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 119 / 6e-31 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G150300 [exp] 115 / 1e-29 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G159500 [exp] 114 / 2e-29 AT4G23340 402 / 3e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 115 / 3e-29 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.005G113900 [exp] 114 / 6e-29 AT3G51240 598 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004746 [exp] 451 / 1e-160 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 390 / 4e-137 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10034964 [exp] 296 / 1e-99 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10012963 [exp] 290 / 4e-97 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 235 / 6e-76 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 233 / 2e-74 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021002 [exp] 123 / 2e-32 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10018836 [exp] 122 / 5e-32 AT5G51310 348 / 7e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 115 / 1e-29 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041912 [exp] 114 / 5e-29 AT3G51240 603 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.003G079600.1 pacid=42785747 polypeptide=Potri.003G079600.1.p locus=Potri.003G079600 ID=Potri.003G079600.1.v4.1 annot-version=v4.1 ATGGCAGAAACTGTGAAACTCCCAATCATAGACCTCTCCTCGCCCGATCGCATATCTACAGCCAAGTCAATCCGTCAGGCATGCGTGGACTATGGCTTCT TTTACCTAGTGAACCATGGAGTGGAAGGACAACTTCTTAGCAAAGTTTTGGAAGAGAGTAAGAAATTTTTCTCCCTCCCCTTGAACGAGAAGATGAAGCT GTCTCGCAAACACCACAGAGGTTACTCTCCATTGTATGCGGAGAATCTTGACCCCCTTTCAAGATCCGAAGGTGACTCAAAGGAAAGCTTCTATGTTGGT CCTGTGGAGGGGGATATGGCTCAAACTAATCTTAATCAATGGCCTTCACAAGAAATATTCCCATCTTGGAGATTGACAATGGAGTCTTACCATAAAAAAC TTATGTCTGCTGGGAAAAAATTAATCTATTTGATTGCTATGGCTTTAAATCTGGATGAAGATTACTTTGAGAAAGTAGGAGCCTTGGACACACCGAGGGG CTTCCTTCGTCTCTTACATTATCCAGGTGAACTGGGGTGTTTTAATGAGCAAATATATGGCGCTTCTGAACATTCAGATTATGGAATGATTACTCTTCTA GTTAGCGATGGTGTTCCAGGACTTCAGGTTTGTCGGGAGAAATTTAAGCAACCACGGCTGTGGGAAGATGTGCCACACATAAATGGGGCTTTCATAGTTA ACATTGGGGACATGATGGAGAGGTGGACTAATTGTTTGTTCCGGTCAACACTGCATAGAGTGATGCCAGTGGGACAAGAACGCTACTCTTTGGCATTCTT CTTAGATCCCAACCCAGATTGTGTTGTGGAATGTTTGGAAAGTTGTTGCAGTCCATCATGCCCTGCAAGATTCCCCCCCATTCGCAGTGGGGCCTATTTG GAAGAGCGGTTTAAGCTTACATATGGCGAATAA
AA sequence Show only first row Show all	>Potri.003G079600.1 pacid=42785747 polypeptide=Potri.003G079600.1.p locus=Potri.003G079600 ID=Potri.003G079600.1.v4.1 annot-version=v4.1 MAETVKLPIIDLSSPDRISTAKSIRQACVDYGFFYLVNHGVEGQLLSKVLEESKKFFSLPLNEKMKLSRKHHRGYSPLYAENLDPLSRSEGDSKESFYVG PVEGDMAQTNLNQWPSQEIFPSWRLTMESYHKKLMSAGKKLIYLIAMALNLDEDYFEKVGALDTPRGFLRLLHYPGELGCFNEQIYGASEHSDYGMITLL VSDGVPGLQVCREKFKQPRLWEDVPHINGAFIVNIGDMMERWTNCLFRSTLHRVMPVGQERYSLAFFLDPNPDCVVECLESCCSPSCPARFPPIRSGAYL EERFKLTYGE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16770			2-oxoglutarate (2OG) and Fe(II...		Potri.003G079600 [exp]	0	1
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Potri.009G125300 [exp]	7.07	0.8045
AT4G14430		PEC12, IBR10, E...	DELTA\(3\), DELTA\(2\)-ENOYL C...		Potri.010G073700 [exp]	8.00	0.8346
AT5G43280		ATDCI1	"delta\(3,5\),delta\(2,4\)-die...		Potri.001G061000 [exp]	11.22	0.7756
AT3G57280			Transmembrane proteins 14C (.1...		Potri.003G094300 [exp]	14.59	0.8165
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Potri.006G110100 [exp]	19.39	0.8184
AT1G54850			HSP20-like chaperones superfam...		Potri.013G024600 [exp]	20.61	0.7710	HSP1.1
AT3G14770		SWEET2, AtSWEET...	Nodulin MtN3 family protein (....		Potri.001G383000 [exp]	24.18	0.7840
AT2G17710			unknown protein		Potri.005G107800 [exp]	33.04	0.8044
AT1G67325			Ran BP2/NZF zinc finger-like s...		Potri.003G172500 [exp]	35.32	0.7838
AT5G18200			UTP:galactose-1-phosphate urid...		Potri.019G034400 [exp]	38.15	0.7687

Compare expression of checked genes

Potri.003G079600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.