Potri.003G084300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G084300.1 pacid=42787027 polypeptide=Potri.003G084300.1.p locus=Potri.003G084300 ID=Potri.003G084300.1.v4.1 annot-version=v4.1
ATGTGCATAGCTAGTCAGAATCCTAGATGTTTTACTACGAACAGTCCCGGGAGTGCACTTTCTTCACCAGCTTGGGATGCGAAAGCTTCGATAGCAATTG
GAATAAACGAATCAAGAGAAAACAATCGACCTTTTTATTTTATTTTTTCTCCCAGAACTATAAGCGCCAGATTAAGTTGCCCTTACCGCAAGACACAGGC
TTTTGATTCTTGTCAGTATTTTTTTAAACAGGCAGCAGAGAATTCAAATTGGCTAGCAATTAGAACAAATAAATTATACTTTACAGGCACCACTTCAAGG
TTTTTGCAAGGGACAAATCGGCTACCCTTATCTACATTTTTTTTCTGGCCATAA
AA sequence
>Potri.003G084300.1 pacid=42787027 polypeptide=Potri.003G084300.1.p locus=Potri.003G084300 ID=Potri.003G084300.1.v4.1 annot-version=v4.1
MCIASQNPRCFTTNSPGSALSSPAWDAKASIAIGINESRENNRPFYFIFSPRTISARLSCPYRKTQAFDSCQYFFKQAAENSNWLAIRTNKLYFTGTTSR
FLQGTNRLPLSTFFFWP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G084300 0 1
AT1G07130 STN1, ATSTN1 Nucleic acid-binding, OB-fold-... Potri.005G212900 4.89 0.8436
AT3G03740 ATBPM4 BTB-POZ and MATH domain 4 (.1) Potri.019G039500 5.47 0.8361
AT1G04770 Tetratricopeptide repeat (TPR)... Potri.001G050600 6.92 0.7766
Potri.017G061800 17.66 0.7503
Potri.001G174000 24.08 0.8053
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Potri.014G132300 24.67 0.7471
AT5G49480 ACP1, ATCP1 Ca2+-binding protein 1, Ca2+-b... Potri.010G146900 26.00 0.7150 Pt-CP1.1
AT1G66260 RNA-binding (RRM/RBD/RNP motif... Potri.017G129900 33.25 0.6579
Potri.005G123600 33.46 0.7954
AT2G22120 RING/FYVE/PHD zinc finger supe... Potri.005G081500 34.29 0.7286

Potri.003G084300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.