Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 116 / 1e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 114 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 108 / 2e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 99 / 5e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 81 / 9e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46990 65 / 5e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G54620 62 / 1e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 60 / 4e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46980 56 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044100 [exp] 146 / 3e-44 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 123 / 5e-35 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 69 / 1e-14 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 65 / 8e-13 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 60 / 6e-11 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.014G129400 [exp] 53 / 1e-08 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G209800 [exp] 53 / 2e-08 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G023201 [exp] 53 / 4e-08 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 53 / 5e-08 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040119 [exp] 153 / 3e-45 AT5G46930 98 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10019498 [exp] 119 / 2e-33 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10043346 [exp] 102 / 3e-27 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10030926 [exp] 97 / 7e-26 AT5G46930 58 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 82 / 5e-19 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 79 / 6e-18 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 70 / 2e-14 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10020664 [exp] 67 / 9e-14 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10031483 [exp] 65 / 8e-13 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10015199 [exp] 59 / 1e-10 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.003G086500.2 pacid=42785930 polypeptide=Potri.003G086500.2.p locus=Potri.003G086500 ID=Potri.003G086500.2.v4.1 annot-version=v4.1 ATGTTTGGTTTTCTGCCCATATATATATATATATATGGGCAGAAAAAAAGAAAACCTTTACATTCTTCCAGTTCATGCTTGCTACACAGGGTCCATCTTC AAACTCTTACGCGAAGGAATATGAAGCACTCTTTTTCGTTGAGTTTCAACTTTGTTATTGTATTCCTACTTGTTCATGGTTCATTGAGCTTTAACAACTT GCATCACTATTGCGACGAAGCTGCAAAGAGCGATCCAAATCTGAGCTGTGACTTTTGTATAGCATCCCTTGAAGCCATTTCCAAGAGCAAAAATGCAAGC CTTGAAGAATTAGTGGAGATCTCAACTGTGCTAGCCATGTCAAAAGCTACAAACATTAGCTGCTACATTTCACAACTTTTGAAAGCCCAAAATTTAGACA AATACCATACGAGTGCCTTACAAGATTGCTTAGAGCTTTACGCGGATGCAAATTCCACGTTGCATGATTCCATGTGTGATTTGAAGTCCAAAGATTATTC CAAAGCTAATATAGATGCCAGTGCCGCCATGGATTCTTCAAGCACCTGCGAGGATGGTTTCAAGGAGAGGGAAGGCGTGGTCTCTCCCTTGACAAAGGAG AATAACACTTTTTTTCAATTGACCGCAATCATGCTTGCTTTTATCAACATGTTAAGTCGATCATAA
AA sequence Show only first row Show all	>Potri.003G086500.2 pacid=42785930 polypeptide=Potri.003G086500.2.p locus=Potri.003G086500 ID=Potri.003G086500.2.v4.1 annot-version=v4.1 MFGFLPIYIYIYGQKKRKPLHSSSSCLLHRVHLQTLTRRNMKHSFSLSFNFVIVFLLVHGSLSFNNLHHYCDEAAKSDPNLSCDFCIASLEAISKSKNAS LEELVEISTVLAMSKATNISCYISQLLKAQNLDKYHTSALQDCLELYADANSTLHDSMCDLKSKDYSKANIDASAAMDSSSTCEDGFKEREGVVSPLTKE NNTFFQLTAIMLAFINMLSRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46940			Plant invertase/pectin methyle...		Potri.003G086500 [exp]	0	1
AT1G73260		ATKTI1	ARABIDOPSIS THALIANA KUNITZ TR...		Potri.004G000400 [exp]	1.41	0.9993
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Potri.006G188400 [exp]	6.63	0.9975
					Potri.006G261022 [exp]	10.48	0.9975
AT2G39210			Major facilitator superfamily ...		Potri.006G122400 [exp]	12.00	0.9986
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G037000 [exp]	14.49	0.9980
					Potri.006G260985 [exp]	15.77	0.9928
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Potri.013G041900 [exp]	15.87	0.9978
					Potri.006G261111 [exp]	16.97	0.9978
AT3G19660			unknown protein		Potri.001G290200 [exp]	17.57	0.9896
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Potri.019G093800 [exp]	19.07	0.9711

Compare expression of checked genes

Potri.003G086500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.