Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46940 89 / 3e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 69 / 1e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46960 57 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46990 57 / 4e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 56 / 1e-09 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46950 55 / 1e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46980 55 / 2e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 49 / 3e-07 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044100 [exp] 140 / 4e-42 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 123 / 5e-35 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 65 / 3e-13 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.004G016500 [exp] 64 / 7e-13 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 61 / 8e-12 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G102600 [exp] 59 / 7e-11 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023201 [exp] 59 / 2e-10 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 59 / 2e-10 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 54 / 8e-09 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019498 [exp] 116 / 9e-33 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10040119 [exp] 104 / 7e-27 AT5G46930 98 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10043346 [exp] 90 / 9e-23 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 76 / 4e-17 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 74 / 1e-16 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10030926 [exp] 70 / 2e-15 AT5G46930 58 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031483 [exp] 68 / 4e-14 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 67 / 7e-14 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10020664 [exp] 66 / 2e-13 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10041650 [exp] 63 / 3e-12 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.003G086600.1 pacid=42786525 polypeptide=Potri.003G086600.1.p locus=Potri.003G086600 ID=Potri.003G086600.1.v4.1 annot-version=v4.1 ATGAAGCACATCTCTTTCTCTTCCATTGCTCTTTGCTTCCTTTTCTTCTTCTTAGTAACTCCTACTCCTAACAATAGCATTTCAACCCTTGATGCTTCGA CCATCGATATAACAAACCGAACCTGCAAAAAATGTGCGGAGGAATATTCCAAAACTTTCAGCTATGACTTTTGTATAAGCTCTCTCCAAGCAATTCCCGT CAGCCATGTGACAAATATTCACGGACTAGCAATAATTGGCATGGAACTAGCTCTAGAAAATGCAACCAACACCATTTCAACCATTAAGTACTTGTTGAGT TATGGAACTTTAGACCGCTTTGCCTTGGTTGCCTTACAGGATTGTTTGGAACTATATGCAGATGCTCTTGTGACAATAGTAGATGGTGTGGCAGCATTTC TGACAGAACATTATAGTGTCGCTAACGTGAAGGTGAGTGCAGTTATGGAAGCATCAACCACCTGCGAAGAAGGGTTCTCAGATAAGACAGGAGTGGTTTC TCCATTGACAGAAGAGAATTACAATCTCTTCCAGTTATCTGATATAGCACTGTGTATCATTCACATGCTCAGTCTAGCTGTATGTAAATAA
AA sequence Show only first row Show all	>Potri.003G086600.1 pacid=42786525 polypeptide=Potri.003G086600.1.p locus=Potri.003G086600 ID=Potri.003G086600.1.v4.1 annot-version=v4.1 MKHISFSSIALCFLFFFLVTPTPNNSISTLDASTIDITNRTCKKCAEEYSKTFSYDFCISSLQAIPVSHVTNIHGLAIIGMELALENATNTISTIKYLLS YGTLDRFALVALQDCLELYADALVTIVDGVAAFLTEHYSVANVKVSAVMEASTTCEEGFSDKTGVVSPLTEENYNLFQLSDIALCIIHMLSLAVCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G38610			Plant invertase/pectin methyle...		Potri.003G086600 [exp]	0	1
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152900 [exp]	1.00	0.9754
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G072741 [exp]	3.16	0.9676
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Potri.007G093000 [exp]	4.47	0.9534
AT5G26230		MAKR1	membrane-associated kinase reg...		Potri.010G090500 [exp]	6.48	0.9242
AT2G32390		GLR6, ATGLR3.5	glutamate receptor 3.5 (.1.2....		Potri.014G152400 [exp]	7.74	0.9575
AT5G01870			Bifunctional inhibitor/lipid-t...		Potri.016G135800 [exp]	8.66	0.9589
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221900 [exp]	10.95	0.9104
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Potri.008G004700 [exp]	11.48	0.9155
AT4G25640		FFT, ATDTX35	FLOWER FLAVONOID TRANSPORTER, ...		Potri.012G144900 [exp]	11.48	0.9302
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.012G036000 [exp]	12.00	0.9435

Compare expression of checked genes

Potri.003G086600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.