Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44610 397 / 3e-143 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1) AT5G10260 377 / 2e-135 AtRABH1e RAB GTPase homolog H1E (.1) AT2G22290 365 / 3e-130 ATRAB6, ATRAB-H1D, AtRABH1d ARABIDOPSIS RAB GTPASE HOMOLOG 6, ARABIDOPSIS RAB GTPASE HOMOLOG H1D, RAB GTPase homolog H1D (.1) AT4G39890 325 / 2e-114 AtRABH1c RAB GTPase homolog H1C (.1) AT5G64990 315 / 1e-110 AtRABH1a RAB GTPase homolog H1A (.1.2) AT5G45130 159 / 5e-49 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT3G54840 158 / 7e-49 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT4G19640 156 / 5e-48 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT3G11730 146 / 4e-44 ATFP8, AtRABD1 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1) AT4G17170 145 / 1e-43 ATRAB-B1B, AT-RAB2, AtRABB1c, AtRab2A ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G135500 [exp] 405 / 4e-146 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1) Potri.005G075300 [exp] 380 / 2e-136 AT5G10260 400 / 2e-144 RAB GTPase homolog H1E (.1) Potri.001G147900 [exp] 313 / 1e-109 AT2G44610 298 / 2e-103 Ras-related small GTP-binding family protein (.1) Potri.010G226300 [exp] 158 / 1e-48 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.008G035800 [exp] 155 / 8e-48 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.012G117800 [exp] 154 / 2e-47 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 153 / 6e-47 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 147 / 1e-44 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.016G002200 [exp] 146 / 4e-44 AT4G17170 394 / 6e-142 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019501 [exp] 402 / 6e-145 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10043349 [exp] 402 / 6e-145 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10014336 [exp] 381 / 9e-137 AT5G10260 402 / 3e-145 RAB GTPase homolog H1E (.1) Lus10041702 [exp] 380 / 4e-136 AT5G10260 404 / 7e-146 RAB GTPase homolog H1E (.1) Lus10024046 [exp] 380 / 3e-135 AT5G10260 405 / 3e-145 RAB GTPase homolog H1E (.1) Lus10019502 [exp] 214 / 3e-72 AT2G44610 218 / 5e-74 Ras-related small GTP-binding family protein (.1) Lus10026045 [exp] 165 / 2e-52 AT5G10260 209 / 5e-70 RAB GTPase homolog H1E (.1) Lus10028820 [exp] 162 / 3e-50 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10017462 [exp] 161 / 7e-48 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10034903 [exp] 155 / 2e-47 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.003G086700.1 pacid=42785543 polypeptide=Potri.003G086700.1.p locus=Potri.003G086700 ID=Potri.003G086700.1.v4.1 annot-version=v4.1 ATGGCACCAGTTTCAGCTCTTGCAAAGTACAAACTGGTCTTCTTGGGAGACCAATCAGTCGGTAAAACAAGCATCATCACTCGCTTCATGTATGATAAAT TCGATAACACCTACCAGGCTACCATTGGCATTGATTTTCTATCAAAGACCATGTACCTCGAAGACAGAACTATTCGTTTGCAGTTGTGGGATACAGCTGG ACAAGAAAGATTCAGAAGCCTCATTCCAAGTTACATTAGAGATTCCTCAGTTGCTGTCATTGTATTTGACGTTGCAAGTCGGCAATCCTTTCTGAATACT TCAAAATGGATTGAAGAGGTTCGCACTGAGAGGGGCAGCGACGTCATCATTGTCCTTGTTGGGAACAAAACTGACCTTGTGGAGAAAAGGCAAGTTTCTA TAGAAGAAGGAGAAGCTAAAGCTCGTGAACTTAACGTCATGTTTATTGAAACTAGTGCAAAAGCTGGTTTTAATATCAAGCCTTTGTTCCGAAAAATTGC TGCAGCGTTGCCAGGAATGGAGGCACTTTCTTCAACAAAGCAAGAGGACATGGTTGATGTGAACCTAAAGTCTACTGGTGGATCTGCCTCCCAGAATCAG GCGCAGTCAGGTGGATGTGCTTGTTGA
AA sequence Show only first row Show all	>Potri.003G086700.1 pacid=42785543 polypeptide=Potri.003G086700.1.p locus=Potri.003G086700 ID=Potri.003G086700.1.v4.1 annot-version=v4.1 MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNT SKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKARELNVMFIETSAKAGFNIKPLFRKIAAALPGMEALSSTKQEDMVDVNLKSTGGSASQNQ AQSGGCAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.003G086700 [exp]	0	1
AT2G23940			Protein of unknown function (D...		Potri.018G101100 [exp]	1.73	0.9006
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Potri.013G062900 [exp]	5.00	0.8887
AT4G11150		TUFF, EMB2448, ...	embryo defective 2448, vacuola...		Potri.013G051500 [exp]	8.94	0.8992
AT1G67250			Proteasome maturation factor U...		Potri.006G249600 [exp]	9.89	0.8817
AT5G58030			Transport protein particle (TR...		Potri.018G110000 [exp]	10.81	0.8818
AT2G43640			Signal recognition particle, S...		Potri.013G125200 [exp]	14.89	0.8952
AT4G34720		ATVHA-C1, AVA-P...	VACUOLAR H+-PUMPING ATPASE C1,...		Potri.009G125000 [exp]	15.65	0.8691	Pt-AVAP5.2
AT2G30942			Protein of unknown function (D...		Potri.002G263300 [exp]	15.84	0.8153
AT3G11780			MD-2-related lipid recognition...		Potri.006G201400 [exp]	16.61	0.8890
AT3G13235		DDI1	DNA-damage inducible 1, ubiqui...		Potri.001G469300 [exp]	20.68	0.8454

Compare expression of checked genes

Potri.003G086700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.