Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27945 60 / 9e-12 Transducin/WD40 repeat-like superfamily protein (.1) AT5G27570 60 / 1e-11 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 60 / 1e-11 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27080 59 / 1e-11 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 59 / 3e-11 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT4G33270 59 / 3e-11 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G11920 49 / 9e-08 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT5G13840 47 / 4e-07 FZR3 FIZZY-related 3 (.1.2) AT4G22910 45 / 2e-06 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G110300 [exp] 83 / 7e-20 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 61 / 5e-12 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 61 / 5e-12 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G118400 [exp] 60 / 1e-11 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 58 / 4e-11 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.010G202100 [exp] 45 / 1e-06 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.008G057500 [exp] 45 / 2e-06 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.001G112700 [exp] 43 / 7e-06 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.003G119500 [exp] 42 / 2e-05 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043009 [exp] 65 / 2e-13 AT4G33270 344 / 1e-114 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 59 / 3e-11 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 59 / 4e-11 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 58 / 4e-11 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 54 / 5e-10 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 55 / 6e-10 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 52 / 5e-09 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 52 / 6e-09 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10011833 [exp] 50 / 2e-08 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10023401 [exp] 45 / 1e-06 AT5G13840 546 / 0.0 FIZZY-related 3 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G089000.1 pacid=42787214 polypeptide=Potri.003G089000.1.p locus=Potri.003G089000 ID=Potri.003G089000.1.v4.1 annot-version=v4.1 ATGCCCAAAGCACTTGCTTGGTGTCCCTATCAATTCAATGGACTGGCCTCGGGAGGAGGCACCGGAGATGGATGCATTACGATATGGAATATAAAAGTAG GGACTTGTACTCGTAGCATTGAAACCAAAGCACTGGCGAGTTATGCTTTGTGGGATCTTTTACTTACTTATCTTGTGTGTGATTGCCTCATAAACTCCAT CTGCATCATGAGTATTCAATTAAGGATTGGGTGTTTGTTCAGGTGTGTGCTGGTGGGTTGGGAAATTGAGTCTGGACATCTGATAGGACTTTATAGAGGC AATCAGTTTTGA
AA sequence Show only first row Show all	>Potri.003G089000.1 pacid=42787214 polypeptide=Potri.003G089000.1.p locus=Potri.003G089000 ID=Potri.003G089000.1.v4.1 annot-version=v4.1 MPKALAWCPYQFNGLASGGGTGDGCITIWNIKVGTCTRSIETKALASYALWDLLLTYLVCDCLINSICIMSIQLRIGCLFRCVLVGWEIESGHLIGLYRG NQF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27570		AtCDC20.5	cell division cycle 20.5, Tran...		Potri.003G089000 [exp]	0	1
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.017G030600 [exp]	10.19	0.8932
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.017G030400 [exp]	25.74	0.8835
AT2G46150			Late embryogenesis abundant (L...		Potri.014G090900 [exp]	33.54	0.8204
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.008G189400 [exp]	36.08	0.8586
AT4G24700			unknown protein		Potri.012G086000 [exp]	53.10	0.8169
					Potri.005G073733 [exp]	58.58	0.7990
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Potri.005G255900 [exp]	86.94	0.7687
AT3G16190			Isochorismatase family protein...		Potri.003G051700 [exp]	116.34	0.7912
					Potri.010G062440 [exp]	122.74	0.7785
AT2G39830		LRD3, DAR2	LATERAL ROOT DEVELOPMENT 3, DA...		Potri.009G111446 [exp]	145.74	0.7767

Compare expression of checked genes

Potri.003G089000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.