gdcH3,Pt-GDCH.3 (Potri.003G089300) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol gdcH3,Pt-GDCH.3
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32470 259 / 4e-90 Single hybrid motif superfamily protein (.1)
AT2G35370 249 / 8e-86 GDCH glycine decarboxylase complex H (.1)
AT2G35120 195 / 9e-65 Single hybrid motif superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G144800 307 / 6e-109 AT1G32470 255 / 3e-88 Single hybrid motif superfamily protein (.1)
Potri.015G122500 191 / 5e-63 AT2G35120 224 / 2e-76 Single hybrid motif superfamily protein (.1)
Potri.012G123700 189 / 3e-62 AT2G35120 217 / 2e-73 Single hybrid motif superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030979 253 / 1e-87 AT1G32470 254 / 4e-88 Single hybrid motif superfamily protein (.1)
Lus10035374 250 / 4e-86 AT1G32470 254 / 6e-88 Single hybrid motif superfamily protein (.1)
Lus10018319 184 / 4e-60 AT2G35120 244 / 2e-84 Single hybrid motif superfamily protein (.1)
Lus10017133 112 / 2e-32 AT2G35120 162 / 1e-52 Single hybrid motif superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0105 Hybrid PF01597 GCV_H Glycine cleavage H-protein
Representative CDS sequence
>Potri.003G089300.2 pacid=42786642 polypeptide=Potri.003G089300.2.p locus=Potri.003G089300 ID=Potri.003G089300.2.v4.1 annot-version=v4.1
ATGGCACTGAGGTTGTGGGCTTCTTCAACGGCCAATGCACTGAGAATCTCTGTTGCCTCCTCCACAGCTCACCTCTCTCCTTCCTACTCCCTCTCAAGAT
GCTTCTCTACTGTTGTAGATGGGTTGAAGTATGCATCTTCACATGAGTGGGTGAAGCATGAAGGGCCGGTGGCCACTATTGGCATTACAGATCATGCTCA
GGATCATCTGGGAGAAGTAGTGTTCGTAGACTTGCCAGAACCGGAAGGTGCTGTCAGCCAAGGGAAGAGCTTTGGAGCAGTGGAAAGCGTGAAAGCAACT
AGTGATATCAATTCTCCAATCTCCGGCGAGATTGTTGAGGTTAATACAAAGCTTAGTGAAACTCCTGGACTGATAAATAAAAGTCCATATGAAGAGGGAT
GGATGATCAAGGTGAAGCCAAGCAACCCATCAGAATTACAGTCCCTACTTGGTCCAAAGGAATACACAAAATTCTGTGAGGAAGAAGAATCTCATTAG
AA sequence
>Potri.003G089300.2 pacid=42786642 polypeptide=Potri.003G089300.2.p locus=Potri.003G089300 ID=Potri.003G089300.2.v4.1 annot-version=v4.1
MALRLWASSTANALRISVASSTAHLSPSYSLSRCFSTVVDGLKYASSHEWVKHEGPVATIGITDHAQDHLGEVVFVDLPEPEGAVSQGKSFGAVESVKAT
SDINSPISGEIVEVNTKLSETPGLINKSPYEEGWMIKVKPSNPSELQSLLGPKEYTKFCEEEESH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G32470 Single hybrid motif superfamil... Potri.003G089300 0 1 gdcH3,Pt-GDCH.3
AT2G26500 cytochrome b6f complex subunit... Potri.004G147300 1.00 0.9866
AT5G40950 RPL27 ribosomal protein large subuni... Potri.001G329500 2.82 0.9859 Pt-RPL27.5
AT1G64150 Uncharacterized protein family... Potri.003G134300 3.00 0.9789
AT2G21960 unknown protein Potri.005G084400 3.87 0.9780
AT3G63140 CSP41A chloroplast stem-loop binding ... Potri.002G053000 4.00 0.9789
AT1G32080 AtLrgB membrane protein, putative (.1... Potri.003G099600 5.09 0.9748
AT1G29070 Ribosomal protein L34 (.1) Potri.011G064800 7.00 0.9770
AT4G01310 Ribosomal L5P family protein (... Potri.002G154600 7.74 0.9771
AT1G56190 Phosphoglycerate kinase family... Potri.008G084500 7.74 0.9758
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Potri.016G027600 8.24 0.9697

Potri.003G089300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.