Potri.003G090300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32540 194 / 1e-64 LOL1 lsd one like 1 (.1.2.3)
AT4G20380 116 / 3e-33 LSD1 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
AT4G21610 98 / 1e-26 LOL2 lsd one like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G143900 204 / 2e-68 AT1G32540 189 / 9e-63 lsd one like 1 (.1.2.3)
Potri.011G154800 128 / 3e-38 AT4G20380 205 / 5e-68 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
Potri.001G442400 121 / 2e-35 AT4G20380 195 / 3e-64 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
Potri.004G043100 87 / 2e-22 AT4G21610 131 / 7e-40 lsd one like 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030969 199 / 2e-66 AT1G32540 236 / 5e-81 lsd one like 1 (.1.2.3)
Lus10035361 199 / 2e-66 AT1G32540 233 / 5e-80 lsd one like 1 (.1.2.3)
Lus10040081 189 / 2e-61 AT1G32540 227 / 3e-76 lsd one like 1 (.1.2.3)
Lus10008066 147 / 4e-45 AT4G20380 212 / 6e-70 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
Lus10023392 140 / 6e-43 AT4G20380 210 / 6e-70 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
Lus10038409 142 / 1e-41 AT1G32540 179 / 2e-55 lsd one like 1 (.1.2.3)
Lus10000782 120 / 2e-35 AT4G20380 160 / 4e-51 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8)
Lus10020766 88 / 2e-22 AT4G21610 133 / 3e-40 lsd one like 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06943 zf-LSD1 LSD1 zinc finger
Representative CDS sequence
>Potri.003G090300.1 pacid=42786388 polypeptide=Potri.003G090300.1.p locus=Potri.003G090300 ID=Potri.003G090300.1.v4.1 annot-version=v4.1
ATGCCAGTTCCTCTTGCACCTTATCCAACACCTCCAGCCCCATATGCTCCTACCCCTCCTCCTCCTCCTCCTCCTCCTCCAGCAGCCAATGGTGCACAGA
GCCAGCTTGTGTGTTCTGGATGTCGAAACCTGTTGCTCTTTCCAGTTGGAGCAACCTCTGTATGCTGTGCTGTTTGCAATGCAGTCACAGCTGTGCCACC
TCCTGGCACGGAAATGGCCCAGTTGGTTTGTGGAGGTTGCCACACCTTACTCATGTACATCCGTGGAGCAACCAGTGTGCAGTGTTCTTGTTGTCACACA
GTCAATCTAGCCTTGGAGGCAAATCAAGTGGCACATGTCAATTGCGGGAACTGCAGGATGCTGCTGATGTACCAATATGGAGCACGGTCTGTGAAATGTG
CTGTTTGCAATTTTGTGACACCAATTGGGGTCTCGACAAGCGCCACTGAAGAGAAGTTCAATGCCTGA
AA sequence
>Potri.003G090300.1 pacid=42786388 polypeptide=Potri.003G090300.1.p locus=Potri.003G090300 ID=Potri.003G090300.1.v4.1 annot-version=v4.1
MPVPLAPYPTPPAPYAPTPPPPPPPPPAANGAQSQLVCSGCRNLLLFPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHT
VNLALEANQVAHVNCGNCRMLLMYQYGARSVKCAVCNFVTPIGVSTSATEEKFNA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G32540 LOL1 lsd one like 1 (.1.2.3) Potri.003G090300 0 1
AT2G28320 Pleckstrin homology (PH) and l... Potri.009G011200 6.55 0.8498
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Potri.012G070500 10.09 0.8314
AT5G18940 Mo25 family protein (.1.2) Potri.010G028700 13.41 0.8285
AT1G56720 Protein kinase superfamily pro... Potri.005G003300 31.36 0.8053
AT2G35880 TPX2 (targeting protein for Xk... Potri.006G200400 32.71 0.8022
AT4G18780 LEW2, IRX1, ATC... LEAF WILTING 2, IRREGULAR XYLE... Potri.004G059600 32.77 0.8004 CESA.2
AT3G24740 Protein of unknown function (D... Potri.002G216600 33.76 0.7866
Potri.008G100650 35.88 0.7389
AT3G51150 ATP binding microtubule motor ... Potri.005G116900 40.00 0.7755
AT1G28240 Protein of unknown function (D... Potri.011G053000 41.37 0.7916

Potri.003G090300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.