Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17900 289 / 5e-100 PLATZ transcription factor family protein (.1.2) AT1G32700 287 / 2e-99 PLATZ transcription factor family protein (.1.2) AT1G21000 219 / 4e-72 PLATZ transcription factor family protein (.1.2) AT1G76590 213 / 9e-70 PLATZ transcription factor family protein (.1) AT5G46710 205 / 1e-66 PLATZ transcription factor family protein (.1) AT1G43000 190 / 5e-61 PLATZ transcription factor family protein (.1) AT2G27930 163 / 8e-51 PLATZ transcription factor family protein (.1) AT2G12646 132 / 8e-38 PLATZ transcription factor family protein (.1) AT3G60670 125 / 2e-35 PLATZ transcription factor family protein (.1) AT1G31040 120 / 1e-33 PLATZ transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G141500 [exp] 364 / 2e-129 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2) Potri.013G078500 [exp] 301 / 2e-104 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2) Potri.019G051200 [exp] 301 / 2e-104 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2) Potri.002G002200 [exp] 231 / 1e-76 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2) Potri.005G259000 [exp] 230 / 1e-76 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2) Potri.006G119400 [exp] 209 / 7e-69 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1) Potri.016G097100 [exp] 207 / 7e-68 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2) Potri.001G212400 [exp] 199 / 7e-65 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1) Potri.009G003200 [exp] 195 / 3e-63 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030968 [exp] 334 / 3e-117 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2) Lus10040082 [exp] 327 / 1e-114 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2) Lus10000482 [exp] 303 / 4e-105 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2) Lus10004577 [exp] 302 / 8e-105 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2) Lus10020337 [exp] 278 / 1e-94 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2) Lus10000952 [exp] 213 / 3e-69 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2) Lus10002700 [exp] 211 / 5e-68 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2) Lus10027735 [exp] 204 / 2e-66 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2) Lus10040292 [exp] 200 / 1e-64 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2) Lus10023411 [exp] 203 / 2e-64 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04640 [poplar] [flax] PLATZ PLATZ transcription factor
Representative CDS sequence Show only first row Show all	>Potri.003G092800.1 pacid=42785838 polypeptide=Potri.003G092800.1.p locus=Potri.003G092800 ID=Potri.003G092800.1.v4.1 annot-version=v4.1 ATGGGAGCTGGAGGACCTGATGATGAGGACCACAGGTGGCCGCCATGGCTAAAACCTTTGTTGCGCGAGAGATTCTTTGTTCAATGTAAGATGCACGCTG ATTCACACAAGAGTGAATGCAACATGTATTGTTTGGATTGTATGAGTGGTGCTCTTTGCTCTCTCTGCCTTGCCTACCACAAGGATCACCGTGCTATTCA GATAAGGAGGTCCTCATACCATGATGTGATAAGGGTTTCTGAAATACAGAAGGTGCTAGACATCACTGGTGTCCAAACTTATGTTATCAACAGTGCTAGA GTTGTGTTTTTGAACGAGAGGCCTCAGCCAAGGCCTGGAAAAGGTGTAACCAACACCTGCGAGGTCTGCGAGCGCAGCCTCCTCGATTCCTTCCGCTTCT GCTCTCTTGGGTGCAAGATTGTTGGTACTTCAAAGAACTTCCAGAAGAGGAAGAAACAACAAATGTCCATGGCATCGGATTCGGAGGACTCTTATAGCAG CAGCAGCAGTCATGGGCAGTACATGAAGACGAAGAACAATGACAACAAAGTGCAGAGCTTCTCCCCCTCTACACCACCTCCAACGCCTGCTAGTCACCGG GCAGCAAAGCGAAGAAAGGGAATCCCCCACCGAGCCCCAATGGGAGGACTAATAATAGAATATTAG
AA sequence Show only first row Show all	>Potri.003G092800.1 pacid=42785838 polypeptide=Potri.003G092800.1.p locus=Potri.003G092800 ID=Potri.003G092800.1.v4.1 annot-version=v4.1 MGAGGPDDEDHRWPPWLKPLLRERFFVQCKMHADSHKSECNMYCLDCMSGALCSLCLAYHKDHRAIQIRRSSYHDVIRVSEIQKVLDITGVQTYVINSAR VVFLNERPQPRPGKGVTNTCEVCERSLLDSFRFCSLGCKIVGTSKNFQKRKKQQMSMASDSEDSYSSSSSHGQYMKTKNNDNKVQSFSPSTPPPTPASHR AAKRRKGIPHRAPMGGLIIEY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G17900			PLATZ transcription factor fam...		Potri.003G092800 [exp]	0	1
AT3G20770	EIL	AtEIN3, EIN3	ETHYLENE-INSENSITIVE3, Ethylen...		Potri.009G159200 [exp]	1.00	0.9285	EIN3A,EIN3.2
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.019G123500 [exp]	3.46	0.9253
AT5G46410		SSP4	SCP1-like small phosphatase 4 ...		Potri.001G353700 [exp]	4.24	0.9186
AT4G28400			Protein phosphatase 2C family ...		Potri.006G081400 [exp]	4.89	0.8936
AT3G60380			unknown protein		Potri.002G136600 [exp]	5.74	0.8553
AT5G66850		MAPKKK5	mitogen-activated protein kina...		Potri.014G035500 [exp]	6.92	0.9147
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Potri.019G003300 [exp]	10.67	0.8949
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Potri.004G091300 [exp]	10.95	0.8914
AT1G73730	EIL	AtEIL3, ATSLIM,...	ARABIDOPSIS THALIANA SULFUR LI...		Potri.001G015900 [exp]	11.95	0.8889	Pt-EIL3.2
AT5G48655			RING/U-box superfamily protein...		Potri.003G148300 [exp]	12.64	0.8927

Compare expression of checked genes

Potri.003G092800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.