Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) AT1G32250 220 / 2e-74 Calcium-binding EF-hand family protein (.1) AT1G18530 134 / 2e-40 EF hand calcium-binding protein family (.1) AT3G25600 127 / 4e-38 Calcium-binding EF-hand family protein (.1) AT1G66410 120 / 3e-35 ACAM-4, CAM4 calmodulin 4 (.1.2) AT5G37780 120 / 3e-35 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT3G56800 120 / 4e-35 ACAM-3, CAM3 calmodulin 3 (.1) AT2G27030 120 / 4e-35 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT2G41110 120 / 4e-35 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT3G43810 119 / 9e-35 CAM7 calmodulin 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G138000 [exp] 286 / 9e-101 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.010G132800 [exp] 133 / 3e-40 AT3G25600 229 / 4e-78 Calcium-binding EF-hand family protein (.1) Potri.015G052600 [exp] 129 / 1e-38 AT1G18530 213 / 8e-72 EF hand calcium-binding protein family (.1) Potri.006G026700 [exp] 119 / 9e-35 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 119 / 9e-35 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.016G024700 [exp] 119 / 9e-35 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.015G032600 [exp] 116 / 7e-34 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.001G222200 [exp] 117 / 1e-33 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.010G080900 [exp] 116 / 1e-33 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004610 [exp] 224 / 5e-76 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10030986 [exp] 207 / 3e-69 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1) Lus10004539 [exp] 169 / 3e-55 AT3G03000 164 / 2e-53 EF hand calcium-binding protein family (.1) Lus10017900 [exp] 131 / 2e-39 AT3G25600 252 / 4e-87 Calcium-binding EF-hand family protein (.1) Lus10035383 [exp] 130 / 6e-39 AT1G32250 152 / 8e-48 Calcium-binding EF-hand family protein (.1) Lus10027283 [exp] 119 / 1e-34 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 119 / 1e-34 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 119 / 1e-34 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10041288 [exp] 119 / 1e-34 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10039391 [exp] 112 / 4e-32 AT4G14640 268 / 1e-93 calmodulin-like 8, calmodulin 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.003G095700.4 pacid=42786976 polypeptide=Potri.003G095700.4.p locus=Potri.003G095700 ID=Potri.003G095700.4.v4.1 annot-version=v4.1 ATGAGCAACAAGCAACCAGCTGTGAAGCTAGATGATGAGCAAATTTCTGAGCTACGGGAAATATTTCGTTCTTTTGATCGAAACAATGATGGAAGCTTAA CGCAGCTTGAGTTAGGCTCACTCTTGCGGTCCTTAGGACTAAAACCTAGTCCTGACCAGCTTGAAACCTTAATTCATAAGGCAGATACAAACAGCAACGG TTTAATTGAGTTCTCAGAGTTTGTGGCTCTGGTGGCACCAGAACTGCTTCCGGAGAAGTCACCGTATAGCGAGGAGCAGCTAAAGCATCTGTTCAAGATG TTTGATAGAGACGGTAATGGGTTTATTACAGCAGCCGAGTTGGCACATTCGATGGCAAAACTTGGGCATGCTCTTACAGCAGAGGAATTGACAGGGATGA TCAAGGAGGCAGACACTGACGGGGATGGAAGAATAAGTTTCCAGGAGTTTTCCCAGGCAATCACATCAGCTGCTTTTGATAATTCTTGGGTTTGA
AA sequence Show only first row Show all	>Potri.003G095700.4 pacid=42786976 polypeptide=Potri.003G095700.4.p locus=Potri.003G095700 ID=Potri.003G095700.4.v4.1 annot-version=v4.1 MSNKQPAVKLDDEQISELREIFRSFDRNNDGSLTQLELGSLLRSLGLKPSPDQLETLIHKADTNSNGLIEFSEFVALVAPELLPEKSPYSEEQLKHLFKM FDRDGNGFITAAELAHSMAKLGHALTAEELTGMIKEADTDGDGRISFQEFSQAITSAAFDNSWV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G03000			EF hand calcium-binding protei...		Potri.003G095700 [exp]	0	1
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Potri.015G099600 [exp]	2.82	0.8325
AT2G36080	B3	ABS2, NGAL1	AP2/B3-like transcriptional fa...		Potri.006G208100 [exp]	4.00	0.8384
AT4G08330			unknown protein		Potri.014G197000 [exp]	4.47	0.8441
AT1G05100		MAPKKK18	mitogen-activated protein kina...		Potri.014G155000 [exp]	8.71	0.7890	MAPKKK15.2
AT4G02110			transcription coactivators (.1...		Potri.002G197400 [exp]	11.40	0.8057
AT1G66740		AtSP7, SGA2, AS...	ANTI- SILENCING FUNCTION 1A, A...		Potri.017G121100 [exp]	14.56	0.7575	SGA902
AT3G55420			unknown protein		Potri.010G203900 [exp]	17.94	0.8174
AT1G29240			Protein of unknown function (D...		Potri.004G057800 [exp]	18.00	0.8387
					Potri.001G042100 [exp]	21.33	0.7761
AT4G20820			FAD-binding Berberine family p...		Potri.001G461500 [exp]	21.44	0.7268

Compare expression of checked genes

Potri.003G095700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.