Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74340 37 / 5e-05 DPMS2, DPMS dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G138100 [exp] 40 / 3e-06 AT1G74340 124 / 3e-39 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030984 [exp] 42 / 8e-07 AT1G74340 120 / 2e-37 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1) Lus10035381 [exp] 40 / 4e-06 AT1G74340 120 / 2e-37 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07297 [poplar] [flax] DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
Representative CDS sequence Show only first row Show all	>Potri.003G095701.2 pacid=42785620 polypeptide=Potri.003G095701.2.p locus=Potri.003G095701 ID=Potri.003G095701.2.v4.1 annot-version=v4.1 ATGGAGTTAGCAGACAGGGCAGTTGGGTTTTTGTTATCTTTAATCAGCATATTGATCTTCACTTATTATACTTTCTGGGCTATCCGTGGGCATTTTTTGA GCTTCCTTCCCTCCACCACCTCGGTCTTTTCCTCGGGCGTTTGTGTGCGTGTGCGCTTGTATATTTAG
AA sequence Show only first row Show all	>Potri.003G095701.2 pacid=42785620 polypeptide=Potri.003G095701.2.p locus=Potri.003G095701 ID=Potri.003G095701.2.v4.1 annot-version=v4.1 MELADRAVGFLLSLISILIFTYYTFWAIRGHFLSFLPSTTSVFSSGVCVRVRLYI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G74340		DPMS2, DPMS	dolichol phosphate mannose syn...		Potri.003G095701 [exp]	0	1
AT2G41900	C3HZnF	OXS2	OXIDATIVE STRESS 2, CCCH-type ...		Potri.006G053800 [exp]	8.94	0.7267
AT4G12400		Hop3	Hop3, stress-inducible protein...		Potri.001G119500 [exp]	10.34	0.7393	STI.2
AT5G03160		ATP58IPK	homolog of mamallian P58IPK (....		Potri.016G088600 [exp]	14.83	0.7247
					Potri.001G400401 [exp]	18.97	0.7164
AT1G09780		iPGAM1	2,3-biphosphoglycerate-indepen...		Potri.016G142900 [exp]	19.51	0.7250	APGM.2
AT4G38870			F-box and associated interacti...		Potri.008G144000 [exp]	21.44	0.7025
AT2G20280	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.006G132800 [exp]	22.18	0.6543
AT5G61790		CNX1, ATCNX1	calnexin 1 (.1)		Potri.015G109200 [exp]	25.29	0.6871	CNX1.1
AT1G10240	FAR1_related	FRS11	FAR1-related sequence 11 (.1)		Potri.004G227400 [exp]	29.29	0.7131
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Potri.005G241100 [exp]	30.57	0.6946

Compare expression of checked genes

Potri.003G095701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.