Potri.003G097900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G124500 85 / 2e-20 AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G122100 84 / 8e-20 AT1G73325 61 / 3e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007700 72 / 2e-15 AT1G73325 62 / 1e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124750 70 / 7e-15 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124400 70 / 9e-15 AT1G73325 56 / 2e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124432 69 / 1e-14 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G010111 68 / 4e-14 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007911 68 / 4e-14 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007800 68 / 4e-14 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039210 60 / 6e-11 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 56 / 3e-09 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 54 / 1e-08 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 53 / 1e-08 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 53 / 2e-08 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 53 / 2e-08 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 53 / 2e-08 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 52 / 4e-08 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 52 / 5e-08 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 52 / 5e-08 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Potri.003G097900.2 pacid=42785409 polypeptide=Potri.003G097900.2.p locus=Potri.003G097900 ID=Potri.003G097900.2.v4.1 annot-version=v4.1
ATGAAGATCCCTAAGCTGATGTTCTCCTTCCTTCTCTTTGCCTTGACAGCAATATCATTTCAAAGGGCCATTGATGCTCAAGGTCCCAAAGAAGCGGTGG
TTGATTCAAATGATAACGAGGTTCTCCTGGGTTTAGATTATTACATCGCAGTCACCAGTCCATTTGACGGGATGTCTCTAGCCATGGAAGCCAGCTGCCC
ACCTCCTGTTGTGCACAGGAACAATCTCTCTTTGCTTCCGATAAAATTCTCATCGGTGGTTGATTCCAATGACAATGTGGTCCGAGAAGACACTAGTCTG
AACTTGGAGTTCAATGTCGAGCTCAACAACAGTGATTGTAACGTGCCGACCATTTGGAAAGTTGAGTTTAATGCATCCATGCAACAATGGCTGGTTATGA
TCGGTGGGGATCGAAGTCATAATCGGTTTCAGATTGCCAAGGCATGCCCATATAGAAAATATTTCTATCAGCTTCGTTACTGCCCGGTTCTCGGGTCCAT
CCAATTCCCTTGCGTTACAGTTCGCTCTCTTTTCAAGAATGGATTAAACTATCTGGCTCTCAATGGCGATCCTATAGCAATTGTGCTGGGGCAGCTTGTA
TCTTCAACATGA
AA sequence
>Potri.003G097900.2 pacid=42785409 polypeptide=Potri.003G097900.2.p locus=Potri.003G097900 ID=Potri.003G097900.2.v4.1 annot-version=v4.1
MKIPKLMFSFLLFALTAISFQRAIDAQGPKEAVVDSNDNEVLLGLDYYIAVTSPFDGMSLAMEASCPPPVVHRNNLSLLPIKFSSVVDSNDNVVREDTSL
NLEFNVELNNSDCNVPTIWKVEFNASMQQWLVMIGGDRSHNRFQIAKACPYRKYFYQLRYCPVLGSIQFPCVTVRSLFKNGLNYLALNGDPIAIVLGQLV
SST

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G097900 0 1
AT3G16110 ATPDI4, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Potri.001G183500 5.56 0.8619
AT5G17050 UGT78D2 UDP-glucosyl transferase 78D2 ... Potri.009G078400 11.31 0.8140 UF3.3
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Potri.009G026800 17.66 0.8504
AT4G35730 Regulator of Vps4 activity in ... Potri.007G059800 37.34 0.8470
AT4G30380 EXLB2 Barwin-related endoglucanase (... Potri.006G249500 38.15 0.7858
AT1G31335 unknown protein Potri.003G148100 45.60 0.8415
AT3G14060 unknown protein Potri.003G067200 48.46 0.7892
AT1G29240 Protein of unknown function (D... Potri.011G067000 48.88 0.8370
AT1G03820 unknown protein Potri.007G137001 53.11 0.8342
AT5G51545 LPA2 low psii accumulation2 (.1) Potri.012G128000 53.44 0.8042

Potri.003G097900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.