Potri.003G099900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45590 134 / 2e-40 Ribosomal protein L35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G133600 215 / 1e-72 AT5G45590 105 / 3e-29 Ribosomal protein L35 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010406 136 / 4e-41 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10010409 136 / 4e-41 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10012140 118 / 6e-34 AT5G45590 148 / 7e-46 Ribosomal protein L35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01632 Ribosomal_L35p Ribosomal protein L35
Representative CDS sequence
>Potri.003G099900.1 pacid=42784800 polypeptide=Potri.003G099900.1.p locus=Potri.003G099900 ID=Potri.003G099900.1.v4.1 annot-version=v4.1
ATGCAGAGATTATGCACCAAGCTCCGATCTTTAGCCTCTGTTTCCTCCTCACATCGCCTCCTCCACCCGCCTCCACAATCTTATCACCGACATCTCCATT
TCGCCGCTGCTTCCCGTAAATGGAATCTTAATGGGTCCCTTTTGAACACATCTTCTTCTTTACCAATTCAGCTTCCTTCGGTGGCAGCTCTGTCCTCTTC
GCGTCTGTCTCAACTCCCCCACTCGTTGGTGCAAGTGCGTCATGTTTCATCAAGGGAGCGGAAAAAGAGGAGGAAGCCAATGACTCCACGCACCTCCAAA
GTAAAAAAGATTAAAATGAAGGCTTACTCGTCCTATAAGGAAAGATTCAGGACAATGAATGATGGGACTATTCGTCGCTGGAGGGAGGGCAAGAATCACA
ATGCGCACTCGAAGTCAAAGAAATCAAAACGTCGACTGAGACAACCATCTACTGTACCTGCAGCCTATGCCAAAGTTATGAAGAAGCTTAATTTCTGTGG
TTAA
AA sequence
>Potri.003G099900.1 pacid=42784800 polypeptide=Potri.003G099900.1.p locus=Potri.003G099900 ID=Potri.003G099900.1.v4.1 annot-version=v4.1
MQRLCTKLRSLASVSSSHRLLHPPPQSYHRHLHFAAASRKWNLNGSLLNTSSSLPIQLPSVAALSSSRLSQLPHSLVQVRHVSSRERKKRRKPMTPRTSK
VKKIKMKAYSSYKERFRTMNDGTIRRWREGKNHNAHSKSKKSKRRLRQPSTVPAAYAKVMKKLNFCG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G45590 Ribosomal protein L35 (.1) Potri.003G099900 0 1
AT3G58470 nucleic acid binding;methyltra... Potri.016G063600 1.00 0.9084
AT5G55140 ribosomal protein L30 family p... Potri.002G225600 2.00 0.8703
AT5G28060 Ribosomal protein S24e family ... Potri.005G049400 3.16 0.8551 Pt-RPS24.1
AT4G28440 Nucleic acid-binding, OB-fold-... Potri.007G137600 3.46 0.8601
AT4G21090 ATMFDX2 ARABIDOPSIS MITOCHONDRIAL FER... Potri.003G182100 3.74 0.8453
AT1G76860 Small nuclear ribonucleoprotei... Potri.002G068800 5.47 0.8464
AT4G31790 Tetrapyrrole (Corrin/Porphyrin... Potri.002G023700 6.24 0.8228
AT4G39280 phenylalanyl-tRNA synthetase, ... Potri.009G116100 6.32 0.8098
AT2G36730 Pentatricopeptide repeat (PPR)... Potri.017G083900 9.79 0.8667
AT5G07900 Mitochondrial transcription te... Potri.004G013100 12.72 0.8125

Potri.003G099900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.