Potri.003G101650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G19112 39 / 2e-05 CPuORF25 conserved peptide upstream open reading frame 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G101650.1 pacid=42785222 polypeptide=Potri.003G101650.1.p locus=Potri.003G101650 ID=Potri.003G101650.1.v4.1 annot-version=v4.1
ATGCCGCTTGGCTTTCAGGTTCTGCTGGGTTCAGATTTAGACAGCTTAGTTTCCTTCCTTAAGACATGGAGAAAGCGTGCTTCTGGTCAAATTGCTTCCA
GCATCGGGTTTTTTCATTCCAAGAAGTGCTCGATTGGCGGTTTCTCATCCTTGGAGATTTTCTGTTGGTTTCCTTTGTCAATTGCACTTAGTGGTTGCTT
TCTTTTTAATGAACAATATAGAGGCGTGATGCAAAATTTTTCTGAGAGAGGTGTTGGTTCTTTGGTGCACTTGGTCAATGCATTGCTGATACAACATCCA
GTTGGAGTTCTTGGCACGCCTTCCGGGGGCTAA
AA sequence
>Potri.003G101650.1 pacid=42785222 polypeptide=Potri.003G101650.1.p locus=Potri.003G101650 ID=Potri.003G101650.1.v4.1 annot-version=v4.1
MPLGFQVLLGSDLDSLVSFLKTWRKRASGQIASSIGFFHSKKCSIGGFSSLEIFCWFPLSIALSGCFLFNEQYRGVMQNFSERGVGSLVHLVNALLIQHP
VGVLGTPSGG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G19112 CPuORF25 conserved peptide upstream ope... Potri.003G101650 0 1
AT5G03280 CKR1, PIR2, ORE... ORESARA 3, ORESARA 2, ENHANCED... Potri.016G090800 7.54 0.7200
AT3G08850 ATRAPTOR1B, RAP... HEAT repeat ;WD domain, G-beta... Potri.006G106600 25.37 0.6862
AT1G30650 WRKY ATWRKY14, AR411... WRKY DNA-binding protein 14 (.... Potri.001G460600 74.76 0.6063 Pt-WRKY14.2
AT3G52570 alpha/beta-Hydrolases superfam... Potri.016G076601 83.24 0.5656
AT1G49040 SCD1 STOMATAL CYTOKINESIS-DEFECTIVE... Potri.015G049500 84.72 0.5836 SCD1.3
AT1G80260 EMB1427 embryo defective 1427, Spc97 /... Potri.014G184801 89.73 0.5674
AT1G15240 Phox-associated domain;Phox-li... Potri.001G183100 89.78 0.6043
AT1G15750 TPL, WSIP1 WUS-INTERACTING PROTEIN 1, TOP... Potri.001G200500 100.68 0.5438
AT5G50350 unknown protein Potri.012G094200 126.11 0.5640
AT1G03060 SPI SPIRRIG, Beige/BEACH domain ;W... Potri.002G047700 131.03 0.5485

Potri.003G101650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.