Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61700 138 / 5e-45 RNA polymerases N / 8 kDa subunit (.1) AT1G11475 138 / 6e-45 NRPE10, NRPD10, NRPB10 RNA polymerases N / 8 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G136300 [exp] 148 / 6e-49 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008095 [exp] 135 / 2e-43 AT1G61700 132 / 5e-42 RNA polymerases N / 8 kDa subunit (.1) Lus10013128 [exp] 132 / 3e-42 AT1G61700 129 / 1e-40 RNA polymerases N / 8 kDa subunit (.1) Lus10025907 [exp] 106 / 3e-32 AT1G61700 105 / 5e-32 RNA polymerases N / 8 kDa subunit (.1) Lus10038195 [exp] 106 / 4e-32 AT1G61700 105 / 6e-32 RNA polymerases N / 8 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01194 [poplar] [flax] RNA_pol_N RNA polymerases N / 8 kDa subunit
Representative CDS sequence Show only first row Show all	>Potri.003G102900.3 pacid=42787401 polypeptide=Potri.003G102900.3.p locus=Potri.003G102900 ID=Potri.003G102900.3.v4.1 annot-version=v4.1 ATGATTATCCCAGTTCGTTGTTTCACTTGCGGCAAGGTGATTGGGAACAAATGGGATACGTATCTTGATCTTCTCCAAGCTGATTACACTGAAGGAGATG CTCTTGATGCGTTGGGGTTGGTTCGGTATTGCTGTAGAAGAATGCTCATGACTCATGTCGACCTTATTGAGAAGCTTCTGAACTACAATACTCTGGAGAA AAGTGAGGGCAGTTGA
AA sequence Show only first row Show all	>Potri.003G102900.3 pacid=42787401 polypeptide=Potri.003G102900.3.p locus=Potri.003G102900 ID=Potri.003G102900.3.v4.1 annot-version=v4.1 MIIPVRCFTCGKVIGNKWDTYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNTLEKSEGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61700			RNA polymerases N / 8 kDa subu...		Potri.003G102900 [exp]	0	1
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.014G158300 [exp]	1.41	0.7384	SMT3.2
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.005G208100 [exp]	5.91	0.6969	OM14.1
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Potri.001G207900 [exp]	6.16	0.7321	EMB143.2
AT1G49245			Prefoldin chaperone subunit fa...		Potri.013G072700 [exp]	6.63	0.7038
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.010G070500 [exp]	15.29	0.7163
AT3G55600			Membrane fusion protein Use1 (...		Potri.018G133700 [exp]	15.49	0.6101
AT3G29130			unknown protein		Potri.011G098200 [exp]	16.12	0.6570
					Potri.001G129500 [exp]	20.04	0.6925
AT1G03150			Acyl-CoA N-acyltransferases (N...		Potri.005G210400 [exp]	20.34	0.6615	SGB903
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.001G167400 [exp]	21.56	0.6270

Compare expression of checked genes

Potri.003G102900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.