Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28530 41 / 5e-05 NAC ANAC074 NAC domain containing protein 74 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G052200 [exp] 47 / 4e-07 AT4G27410 188 / 1e-55 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.006G051400 [exp] 42 / 1e-05 AT3G04070 121 / 1e-31 NAC domain containing protein 47 (.1.2) Potri.001G256600 [exp] 42 / 2e-05 AT3G04070 190 / 7e-56 NAC domain containing protein 47 (.1.2) Potri.001G061200 [exp] 40 / 0.0001 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 40 / 0.0001 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.009G052300 [exp] 39 / 0.0002 AT1G01720 179 / 2e-53 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.017G063300 [exp] 39 / 0.0002 AT5G13180 150 / 9e-45 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G325100 [exp] 39 / 0.0003 AT5G13180 163 / 2e-49 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G206900 [exp] 38 / 0.0003 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002083 [exp] 41 / 4e-05 AT5G08790 225 / 7e-69 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10003847 [exp] 41 / 4e-05 AT1G61110 196 / 3e-60 NAC domain containing protein 25 (.1) Lus10032004 [exp] 38 / 0.0006 AT5G14000 113 / 2e-30 NAC domain containing protein 84 (.1) Lus10035174 [exp] 37 / 0.0008 AT5G14000 115 / 2e-31 NAC domain containing protein 84 (.1) Lus10002581 [exp] 37 / 0.0008 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10001809 [exp] 37 / 0.001 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G103550.1 pacid=42786211 polypeptide=Potri.003G103550.1.p locus=Potri.003G103550 ID=Potri.003G103550.1.v4.1 annot-version=v4.1 ATGGAGTTTCTTAAGGATTCAACGCCGAACATAAAGGTTCCTTTTACAAGTCCATTAGTACCAAACAAGCCTTCTTCAAAGCCATTTTCACCACCTCAAA TCCCCATTTTACACACCCCACCAACACCACCACCACCTTTGGCCACCATTACTTCACCACCACTACCACCACCAACAAAGACTGATTTTATTGATGATTA TTTCAAGAAGCTTCCACCTGGATATAGGTTTTGCCCTTTTGATAATGAAGTGGTGGTGCATTACTTGGCGAAGGCTATGTTTGCTAAGGAACAAGATGGT CGATGTTACACTCTATGA
AA sequence Show only first row Show all	>Potri.003G103550.1 pacid=42786211 polypeptide=Potri.003G103550.1.p locus=Potri.003G103550 ID=Potri.003G103550.1.v4.1 annot-version=v4.1 MEFLKDSTPNIKVPFTSPLVPNKPSSKPFSPPQIPILHTPPTPPPPLATITSPPLPPPTKTDFIDDYFKKLPPGYRFCPFDNEVVVHYLAKAMFAKEQDG RCYTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Potri.003G103550 [exp]	0	1
AT5G20045			unknown protein		Potri.008G015100 [exp]	5.29	0.5674
AT4G38140			RING/U-box superfamily protein...		Potri.004G209600 [exp]	6.78	0.5845
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.003G104600 [exp]	43.35	0.5497
					Potri.004G189850 [exp]	56.99	0.4678
AT4G01960			unknown protein		Potri.002G192700 [exp]	60.20	0.5056
AT5G01720			RNI-like superfamily protein (...		Potri.019G123400 [exp]	63.48	0.5081
AT4G25200		ATHSP23.6-MITO	mitochondrion-localized small ...		Potri.009G021400 [exp]	78.16	0.4804
AT5G10490		MSL2	MSCS-like 2 (.1.2.3)		Potri.005G107200 [exp]	97.85	0.4666
AT1G40390			DNAse I-like superfamily prote...		Potri.003G066101 [exp]	104.27	0.4490
AT2G24670	B3		Domain of unknown function (DU...		Potri.013G065401 [exp]	115.88	0.4486

Compare expression of checked genes

Potri.003G103550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.