Potri.003G103700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31812 138 / 2e-44 ACBP6, ACBP acyl-CoA-binding protein 6 (.1)
AT5G53470 57 / 6e-11 ACBP1 acyl-CoA binding protein 1 (.1)
AT4G27780 51 / 8e-09 ACBP2 acyl-CoA binding protein 2 (.1)
AT4G24230 45 / 6e-07 ACBP3 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
AT5G27630 45 / 1e-06 ACBP5 acyl-CoA binding protein 5 (.1)
AT3G05420 44 / 2e-06 ACBP4 acyl-CoA binding protein 4 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G130200 177 / 1e-59 AT1G31812 140 / 4e-45 acyl-CoA-binding protein 6 (.1)
Potri.005G026900 50 / 2e-08 AT3G05420 1005 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.013G018800 48 / 8e-08 AT3G05420 999 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.012G017700 47 / 2e-07 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1)
Potri.015G010200 47 / 2e-07 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1)
Potri.014G018700 42 / 9e-06 AT4G24230 133 / 2e-35 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Potri.002G120200 41 / 2e-05 AT4G24230 113 / 3e-28 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013605 158 / 4e-52 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1)
Lus10021246 157 / 2e-51 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1)
Lus10029352 145 / 6e-47 AT1G31812 110 / 2e-33 acyl-CoA-binding protein 6 (.1)
Lus10005910 51 / 8e-09 AT4G27780 430 / 3e-151 acyl-CoA binding protein 2 (.1)
Lus10022382 50 / 1e-08 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1)
Lus10029902 49 / 5e-08 AT3G05420 1040 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10004499 49 / 5e-08 AT3G05420 1019 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10031497 48 / 9e-08 AT3G05420 1027 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10015176 48 / 9e-08 AT3G05420 1024 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10007764 39 / 0.0002 AT4G24230 141 / 1e-38 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0632 FERM_M PF00887 ACBP Acyl CoA binding protein
Representative CDS sequence
>Potri.003G103700.3 pacid=42786644 polypeptide=Potri.003G103700.3.p locus=Potri.003G103700 ID=Potri.003G103700.3.v4.1 annot-version=v4.1
ATGGGTTTGCAGGAGGAATTTGAGGAGCACGCTGAGAAAGCCAAGACACTGCCAGAAAATACAACAAATGAGAACAAACTTATTCTCTATGGGCTCTTCA
AGCAAGCCACTGTTGGACTAGTGAACACCAGCCGCCCTGGTATTTTCAACATGAGGGACAGGGCAAAGTGGGATGCATGGAAGGCTGTTGAAGGGAAATC
CAAGGAGGAAGCAATGAGTGACTATATCACCAAGGTTAAGCAGTTGCTGGAAGAAGCTGCTGCTTCTGCCTAG
AA sequence
>Potri.003G103700.3 pacid=42786644 polypeptide=Potri.003G103700.3.p locus=Potri.003G103700 ID=Potri.003G103700.3.v4.1 annot-version=v4.1
MGLQEEFEEHAEKAKTLPENTTNENKLILYGLFKQATVGLVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAAASA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G31812 ACBP6, ACBP acyl-CoA-binding protein 6 (.1... Potri.003G103700 0 1
AT5G16970 AT-AER alkenal reductase (.1) Potri.007G143600 1.73 0.8767
AT3G55360 ECR, CER10, ATT... ENOYL-COA REDUCTASE, ECERIFERU... Potri.008G055400 7.54 0.8474
AT3G51470 Protein phosphatase 2C family ... Potri.007G058700 11.22 0.8121
AT5G67150 HXXXD-type acyl-transferase fa... Potri.003G057001 11.91 0.8559
AT1G42960 unknown protein Potri.007G064100 16.52 0.7944
AT2G31680 AtRABA5d RAB GTPase homolog A5D (.1) Potri.014G150300 17.23 0.8215 ARA.2
AT5G53560 B5#2, ATB5-A, A... ARABIDOPSIS CYTOCHROME B5 ISOF... Potri.011G055236 36.87 0.7775
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Potri.002G229350 48.66 0.7946
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Potri.001G436500 49.35 0.7713
Potri.017G119700 49.98 0.7644

Potri.003G103700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.