Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61230 218 / 4e-73 PIA2, ANK6 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) AT5G07840 207 / 7e-69 PIA1 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) AT5G60070 56 / 2e-09 ankyrin repeat family protein (.1) AT2G03430 55 / 2e-09 Ankyrin repeat family protein (.1) AT5G53470 55 / 3e-09 ACBP1 acyl-CoA binding protein 1 (.1) AT4G19150 54 / 4e-09 Ankyrin repeat family protein (.1.2) AT2G43850 54 / 1e-08 Integrin-linked protein kinase family (.1.2) AT4G27780 52 / 2e-08 ACBP2 acyl-CoA binding protein 2 (.1) AT2G31800 52 / 4e-08 Integrin-linked protein kinase family (.1) AT5G02620 51 / 1e-07 ATANK1, ANK1 ankyrin-like1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G129800 [exp] 250 / 5e-86 AT5G61230 206 / 2e-68 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) Potri.010G185200 [exp] 61 / 4e-11 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.003G103400 [exp] 57 / 4e-10 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G130500 [exp] 57 / 5e-10 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2) Potri.012G017700 [exp] 56 / 1e-09 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.007G145200 [exp] 56 / 1e-09 AT2G31820 751 / 0.0 Ankyrin repeat family protein (.1) Potri.007G142100 [exp] 55 / 5e-09 AT2G43850 726 / 0.0 Integrin-linked protein kinase family (.1.2) Potri.014G051100 [exp] 55 / 5e-09 AT5G51160 209 / 3e-62 Ankyrin repeat family protein (.1) Potri.015G010200 [exp] 54 / 9e-09 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033816 [exp] 238 / 2e-81 AT5G07840 232 / 1e-78 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) Lus10018958 [exp] 231 / 2e-78 AT5G07840 228 / 3e-77 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) Lus10020272 [exp] 56 / 3e-09 AT5G13530 97 / 9e-21 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10010659 [exp] 54 / 1e-08 AT3G03790 1245 / 0.0 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein Lus10001048 [exp] 53 / 2e-08 AT4G19150 230 / 6e-76 Ankyrin repeat family protein (.1.2) Lus10013648 [exp] 53 / 3e-08 AT3G03790 1249 / 0.0 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein Lus10001414 [exp] 52 / 3e-08 AT4G19150 245 / 9e-82 Ankyrin repeat family protein (.1.2) Lus10007432 [exp] 52 / 3e-08 AT2G31800 69 / 3e-13 Integrin-linked protein kinase family (.1) Lus10002621 [exp] 52 / 6e-08 AT5G13530 99 / 6e-22 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10036990 [exp] 52 / 7e-08 AT5G14230 510 / 5e-174 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.003G104400.1 pacid=42784905 polypeptide=Potri.003G104400.1.p locus=Potri.003G104400 ID=Potri.003G104400.1.v4.1 annot-version=v4.1 ATGCCACAGGAAGCTTCTGTTGCGGTTTCGTTGAGGCGTAATTTGTCAAGAAGACGGTCGTCTAGGTCAGTTGGGGATGTGGATAGAGATGATAGAGGCT GGAATTTGCTTCATATTGGTGCTAGAAAAGGTGATCTCAAACAGGTGAAACGTTTACTCGATGAAGGAATGGATGTTAACGTGCCTGCATGGGGCCCAAA ATCAAAAGGCCTGACTCCTCTCCACCTTGCTGCTCAGGGGGGTCACCTTGAGATCATGGCTGAATTGCTCGAGCGTGGTGCTAATATTGATGCTAGAACC TTGGGTGCTTGTGGTTGGACACCACTTCACAGTGCTGCCAAGGAGAGGAAGAAAGAAGCAGTCAAATTTCTCATAGAGAACGGTGCATTCTTGCCAGATG ATATTAATGATAGCAGATTCAACCCACCACTCCATTACTGCCCTGGTCTTGAATGGGCATATGAGGAGATGAAGCGTCATCAGAGAGAGAACTTGTCATC AGGCGAAGCATCTTATAGCTCTGAAAGCTAA
AA sequence Show only first row Show all	>Potri.003G104400.1 pacid=42784905 polypeptide=Potri.003G104400.1.p locus=Potri.003G104400 ID=Potri.003G104400.1.v4.1 annot-version=v4.1 MPQEASVAVSLRRNLSRRRSSRSVGDVDRDDRGWNLLHIGARKGDLKQVKRLLDEGMDVNVPAWGPKSKGLTPLHLAAQGGHLEIMAELLERGANIDART LGACGWTPLHSAAKERKKEAVKFLIENGAFLPDDINDSRFNPPLHYCPGLEWAYEEMKRHQRENLSSGEASYSSES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G61230		PIA2, ANK6	phytochrome interacting ankyri...		Potri.003G104400 [exp]	0	1
AT5G46250			RNA-binding protein (.1.2.3)		Potri.011G080700 [exp]	6.32	0.8126
AT5G11310			Pentatricopeptide repeat (PPR)...		Potri.006G247400 [exp]	8.48	0.7947
AT4G06634	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.003G010400 [exp]	8.77	0.7870
AT2G30120			unknown protein		Potri.001G281400 [exp]	9.05	0.8298
AT5G06810			Mitochondrial transcription te...		Potri.016G048400 [exp]	9.38	0.7932
AT5G04750			F1F0-ATPase inhibitor protein,...		Potri.010G240401 [exp]	16.88	0.7690
AT3G62200			Putative endonuclease or glyco...		Potri.005G003800 [exp]	17.43	0.7817
AT3G52220			unknown protein		Potri.008G019100 [exp]	21.77	0.7914
AT1G50440			RING/FYVE/PHD zinc finger supe...		Potri.008G005800 [exp]	27.71	0.7622
AT4G25180			RNA polymerase III RPC4 (.1)		Potri.003G107300 [exp]	28.56	0.7668

Compare expression of checked genes

Potri.003G104400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.