Plant FIBer expression Database

Potri.003G107501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07630 91 / 6e-23 lipid transporters (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G126200
[exp]
104 / 7e-28 AT5G07630 757 / 0.0 lipid transporters (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038931
[exp]
101 / 9e-28 AT5G07630 302 / 7e-99 lipid transporters (.1)
Lus10027222
[exp]
100 / 2e-26 AT5G07630 557 / 0.0 lipid transporters (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0222 MviN_MATE PF04506 Rft-1 Rft protein
Representative CDS sequence
>Potri.003G107501.2 pacid=42787128 polypeptide=Potri.003G107501.2.p locus=Potri.003G107501 ID=Potri.003G107501.2.v4.1 annot-version=v4.1
ATGTGTTTTCTGTTCACTCATCTATCCTCTCAAAAGCTAATTCTTCAAAAAGAGGAAAAGATTGTTCTTGTATGGTTGGATACCCCAAACAACCAGGCTG
TATATGGACTTGTTCACAAGTTAGGGAGCTTAGTTGTGAGATTGGTGAATCTTCCATTCAAGGAAAGTTCACATGCTACATTTTCCAGGTCTGCATCAGG
TTTATTTCTCTCCTCATTTGTTCTCTTAACATTGTTCTGA
AA sequence
>Potri.003G107501.2 pacid=42787128 polypeptide=Potri.003G107501.2.p locus=Potri.003G107501 ID=Potri.003G107501.2.v4.1 annot-version=v4.1
MCFLFTHLSSQKLILQKEEKIVLVWLDTPNNQAVYGLVHKLGSLVVRLVNLPFKESSHATFSRSASGLFLSSFVLLTLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07630 lipid transporters (.1) Potri.003G107501
[exp]
0 1
Potri.004G011600
[exp]
1.00 0.9228
AT5G17680 disease resistance protein (TI... Potri.019G070393
[exp]
1.41 0.9010
Potri.004G011801
[exp]
7.00 0.8371
Potri.013G075801
[exp]
7.48 0.8474
AT3G42170 BED zinc finger ;hAT family di... Potri.001G383800
[exp]
14.31 0.7671
AT3G14470 NB-ARC domain-containing disea... Potri.006G273900
[exp]
19.07 0.7939
AT1G32960 ATSBT3.3 Subtilase family protein (.1) Potri.011G150900
[exp]
22.60 0.7892
AT3G18670 Ankyrin repeat family protein ... Potri.011G016000
[exp]
29.29 0.8375
Potri.003G175432
[exp]
68.54 0.7991
Potri.018G145574
[exp]
71.44 0.7619

Potri.003G107501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.