Plant FIBer expression Database

Potri.003G108301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G125100
[exp]
92 / 2e-25 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.003G108301.1 pacid=42786280 polypeptide=Potri.003G108301.1.p locus=Potri.003G108301 ID=Potri.003G108301.1.v4.1 annot-version=v4.1
ATGGCATTAATCCCCAAATCATCTCAGTCAACCCATGCCCCCCAACCTAGAAATTCTAGTTCCCACCCATGTATGATTATTATATATAAACACATACACA
CACCTATGTTCTCATCGAATGTGCTTTGTATTACAAGAACAATGGCTTCTAAGAAATTTTTGTGTTTTTGGAATGCTTTCTTGATTGTTATACTTCTTTT
CTCTTCTGCAATGGGATCAAGGGATCTGTCAGAGATTGCCAGGCCTCGTATGATTCTTGAGAAGGCTAGTAGAACTCAAAGGGGTCTTCCACGGGACGGC
AATTATTTGGTTGATCCTCCACCGGCTCATTAG
AA sequence
>Potri.003G108301.1 pacid=42786280 polypeptide=Potri.003G108301.1.p locus=Potri.003G108301 ID=Potri.003G108301.1.v4.1 annot-version=v4.1
MALIPKSSQSTHAPQPRNSSSHPCMIIIYKHIHTPMFSSNVLCITRTMASKKFLCFWNAFLIVILLFSSAMGSRDLSEIARPRMILEKASRTQRGLPRDG
NYLVDPPPAH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G108301
[exp]
0 1
AT4G39230 NmrA-like negative transcripti... Potri.011G168400
[exp]
2.23 0.9892
AT5G24090 ATCHIA chitinase A (.1) Potri.015G024100
[exp]
14.49 0.9888 Pt-CHI3.8
AT4G18540 unknown protein Potri.011G064300
[exp]
19.39 0.9885
AT4G11650 ATOSM34 osmotin 34 (.1) Potri.001G107950
[exp]
23.66 0.9790
AT5G24090 ATCHIA chitinase A (.1) Potri.015G024000
[exp]
23.76 0.9882
AT2G15220 Plant basic secretory protein ... Potri.009G094600
[exp]
29.46 0.9870
AT4G11650 ATOSM34 osmotin 34 (.1) Potri.001G107800
[exp]
30.19 0.9705 Pt-OLP.5
AT3G42880 Leucine-rich repeat protein ki... Potri.006G139700
[exp]
30.59 0.9700
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.004G219900
[exp]
30.74 0.9745
AT4G15550 IAGLU indole-3-acetate beta-D-glucos... Potri.006G055600
[exp]
31.49 0.9868 Pt-ZOG1.15

Potri.003G108301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.