Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) AT1G23220 106 / 5e-30 Dynein light chain type 1 family protein (.1) AT4G27360 78 / 3e-19 Dynein light chain type 1 family protein (.1) AT4G15930 73 / 4e-17 Dynein light chain type 1 family protein (.1) AT1G52240 72 / 4e-17 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 71 / 2e-16 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124700 [exp] 220 / 8e-75 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 139 / 1e-42 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 139 / 2e-42 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 115 / 2e-33 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 114 / 3e-33 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 96 / 2e-24 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.006G091800 [exp] 77 / 5e-19 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.008G219900 [exp] 76 / 4e-18 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 74 / 1e-17 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031734 [exp] 118 / 4e-35 AT1G23220 100 / 6e-29 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 108 / 6e-31 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 108 / 1e-30 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 102 / 3e-27 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 98 / 7e-26 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10004252 [exp] 90 / 2e-21 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10035868 [exp] 73 / 3e-17 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 72 / 6e-17 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 72 / 1e-16 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 71 / 2e-16 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [poplar] [flax] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Potri.003G108700.1 pacid=42786624 polypeptide=Potri.003G108700.1.p locus=Potri.003G108700 ID=Potri.003G108700.1.v4.1 annot-version=v4.1 ATGGAGAGACCACAGTCAGAGACTGGAAGGAGGAGGAGAATGGAAAAGAATAAGGAAAGGGTGCAGTTCCTACCTCCTGGGCGTATGTTACCGGTGCCTC CCATGGTGGGGCCACCAGCAGCAGCAACCAATGAAGTGAGGCTAGCAGCAATAGCTGTCGAGTTGAACATACGGCTGAGATCAGCAGACATGCCTGGTGC AATGCAAGAGCATGCATTTAGGTTCAGTAGAGCACTCCTTGATGCTAATAATCTCGAGAGCAAGAATCCCAATCCTACTCATATCGCCATGAGTCTCAAG AAGGAGTTTGATGCAATGTATGGCATCGCATGGCACTGCATTGTTGGCAAGAGTTATGGGTCATTTGTAACTCACTCAAGTGGTGGATTTGTTTATTTTT CCGTGGACAACCTCTCCTTTCTTTTCAAGACCGAGGTCCAACCAGTGAAGAGGCCACCTCCATTGCGCAAGCTCGAGGCATAA
AA sequence Show only first row Show all	>Potri.003G108700.1 pacid=42786624 polypeptide=Potri.003G108700.1.p locus=Potri.003G108700 ID=Potri.003G108700.1.v4.1 annot-version=v4.1 MERPQSETGRRRRMEKNKERVQFLPPGRMLPVPPMVGPPAAATNEVRLAAIAVELNIRLRSADMPGAMQEHAFRFSRALLDANNLESKNPNPTHIAMSLK KEFDAMYGIAWHCIVGKSYGSFVTHSSGGFVYFSVDNLSFLFKTEVQPVKRPPPLRKLEA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20110			Dynein light chain type 1 fami...		Potri.003G108700 [exp]	0	1
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.002G060900 [exp]	7.34	0.9605
AT3G09870			SAUR-like auxin-responsive pro...		Potri.006G125100 [exp]	11.00	0.9614
AT2G29125		RTFL2, DVL13	DEVIL 13, ROTUNDIFOLIA like 2 ...		Potri.001G242800 [exp]	13.96	0.9541
AT5G45950			GDSL-like Lipase/Acylhydrolase...		Potri.004G051900 [exp]	20.71	0.9603
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Potri.010G165700 [exp]	23.57	0.9599
AT5G15310	MYB	ATMYB16, ATMIXT...	myb domain protein 16 (.1.2)		Potri.008G089700 [exp]	26.64	0.9592
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.017G040700 [exp]	28.98	0.9589
AT4G14930			Survival protein SurE-like pho...		Potri.010G088100 [exp]	30.04	0.9582
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Potri.004G018800 [exp]	30.98	0.9537	Pt-CYP77.2
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Potri.019G022400 [exp]	33.22	0.9581

Compare expression of checked genes

Potri.003G108700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.