Plant FIBer expression Database

Potri.003G112350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12432 47 / 1e-09 CPuORF26 conserved peptide upstream open reading frame 26 (.1)
AT4G22592 46 / 3e-09 CPuORF27 conserved peptide upstream open reading frame 27 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G120550
[exp]
71 / 4e-19 AT4G22592 43 / 5e-08 conserved peptide upstream open reading frame 27 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.003G112350.1 pacid=42785280 polypeptide=Potri.003G112350.1.p locus=Potri.003G112350 ID=Potri.003G112350.1.v4.1 annot-version=v4.1
ATGTTGTGTGGTTTTGGAGATGAGAAGTTCTCAGGAAGTCCCTGCTTGATGGACTGCTCTCCTAGTAGTAGTGACAAGAAAACTTTGAAGAGGTGGTTTT
TCATTGATAAGAGGGTCGGGTGA
AA sequence
>Potri.003G112350.1 pacid=42785280 polypeptide=Potri.003G112350.1.p locus=Potri.003G112350 ID=Potri.003G112350.1.v4.1 annot-version=v4.1
MLCGFGDEKFSGSPCLMDCSPSSSDKKTLKRWFFIDKRVG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G12432 CPuORF26 conserved peptide upstream ope... Potri.003G112350
[exp]
0 1
AT4G12430 TPPF trehalose-6-phosphate phosphat... Potri.003G112400
[exp]
1.00 0.9531
AT3G07990 SCPL27 serine carboxypeptidase-like 2... Potri.010G220200
[exp]
12.72 0.8963
AT2G01170 BAT1 bidirectional amino acid trans... Potri.002G078501
[exp]
19.13 0.8872
AT5G50610 unknown protein Potri.001G059800
[exp]
22.02 0.8080
AT1G11925 Stigma-specific Stig1 family p... Potri.008G220900
[exp]
33.15 0.8725
AT5G49350 Glycine-rich protein family (.... Potri.008G108400
[exp]
36.40 0.8799
AT5G23190 CYP86B1 "cytochrome P450, family 86, s... Potri.005G092200
[exp]
37.70 0.8772
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Potri.010G165300
[exp]
37.94 0.8591
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Potri.001G161200
[exp]
38.18 0.8506
AT4G02370 Protein of unknown function, D... Potri.014G127500
[exp]
41.85 0.8161

Potri.003G112350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.