Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12390 178 / 1e-56 PME1 pectin methylesterase inhibitor 1 (.1) AT1G62770 168 / 5e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 167 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 166 / 3e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 158 / 6e-49 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 132 / 5e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 120 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 119 / 2e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 116 / 9e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 114 / 2e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128700 [exp] 182 / 1e-58 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 176 / 3e-56 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119200 [exp] 160 / 3e-51 AT1G62770 117 / 2e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 148 / 6e-45 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 145 / 4e-44 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 144 / 1e-43 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G145800 [exp] 136 / 3e-40 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128400 [exp] 133 / 3e-39 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 132 / 5e-39 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031133 [exp] 173 / 8e-55 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 164 / 2e-51 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 161 / 3e-50 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 160 / 6e-50 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 138 / 4e-41 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024593 [exp] 132 / 1e-38 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 131 / 2e-38 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 123 / 3e-35 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 118 / 2e-33 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 117 / 7e-33 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.003G113700.1 pacid=42786389 polypeptide=Potri.003G113700.1.p locus=Potri.003G113700 ID=Potri.003G113700.1.v4.1 annot-version=v4.1 ATGGCAAAACTTGTCTCTTTCTTAACGTTGCTTTCCTTTGCCCTCTACATGGTTGGCACGGCAGGGTCTGCCTCCAGCCCCACAGATTTCATCAAGTCCT CATGCAAGGCTACTCGCTATCCAGAGTTATGTGTCGGATGCTTGTCAGGTTATGCTAGTGTCATTCAACGAAATGAGCGACGTCTAGTTCTCACTGCCTT GTCAGTGAGTCTAGCCAGGGCTAGGTCAGCTGCAGCATTTGTGACCAAGATGACTAAAGTTAGGGGGATTAAGCCTAGAGAGTACCAAGCGGCGAAGGAC TGCATAGAAAACATGGGTGATAGTGTGGATCGACTTAGCCAGTCAGTCAGAGAGCTTCGTCATACGGGTCGAGCTGTTGGTCGAGACTTTTTGTGGCATA TGAGTAACGTACAGACTTGGGTTAGTGCTGCACTAACTGATGAGAACACCTGCCTTGATGGGTTTGCTGGCCATCTAATGGATGGAAATGTAAAGGTTGC CATCAAGCGCCGGATCAACAATTTTTCTCAGGTCACTAGCAATGCGCTTGCACTAGTTGATCGTTTTAAATCTAGACACCGTGCCAGAAATCCTTAG
AA sequence Show only first row Show all	>Potri.003G113700.1 pacid=42786389 polypeptide=Potri.003G113700.1.p locus=Potri.003G113700 ID=Potri.003G113700.1.v4.1 annot-version=v4.1 MAKLVSFLTLLSFALYMVGTAGSASSPTDFIKSSCKATRYPELCVGCLSGYASVIQRNERRLVLTALSVSLARARSAAAFVTKMTKVRGIKPREYQAAKD CIENMGDSVDRLSQSVRELRHTGRAVGRDFLWHMSNVQTWVSAALTDENTCLDGFAGHLMDGNVKVAIKRRINNFSQVTSNALALVDRFKSRHRARNP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G12390		PME1	pectin methylesterase inhibito...		Potri.003G113700 [exp]	0	1
AT2G16060		ATGLB1, ARATHGL...	CLASS I HEMOGLOBIN, hemoglobin...		Potri.009G110901 [exp]	1.00	0.8922
AT3G14460			LRR and NB-ARC domains-contain...		Potri.017G121901 [exp]	3.46	0.8548
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Potri.018G145580 [exp]	3.46	0.8483
AT4G31020			alpha/beta-Hydrolases superfam...		Potri.018G111400 [exp]	6.92	0.8342
AT2G40390			unknown protein		Potri.010G183100 [exp]	9.79	0.8016
AT4G17980	NAC	ANAC071	NAC domain containing protein ...		Potri.014G076100 [exp]	9.89	0.7590
AT5G67620			unknown protein		Potri.007G005600 [exp]	15.09	0.7976
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.015G003500 [exp]	16.73	0.7802
AT1G28440		HSL1	HAESA-like 1 (.1)		Potri.017G016600 [exp]	20.78	0.8190
AT3G14470			NB-ARC domain-containing disea...		Potri.014G003600 [exp]	22.44	0.8106

Compare expression of checked genes

Potri.003G113700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.