Plant FIBer expression Database

Potri.003G113900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70250 74 / 8e-16 receptor serine/threonine kinase, putative (.1)
AT1G62790 68 / 5e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G73560 53 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G18280 52 / 8e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G73550 49 / 5e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT5G13900 40 / 0.0001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G48130 38 / 0.0007 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G44290 38 / 0.0008 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G119000
[exp]
142 / 5e-44 AT1G62790 90 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.013G131500
[exp]
49 / 5e-08 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024591
[exp]
82 / 5e-20 AT1G62790 100 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10032228
[exp]
81 / 9e-20 AT1G70250 90 / 1e-23 receptor serine/threonine kinase, putative (.1)
Lus10031335
[exp]
43 / 3e-05 AT3G17910 414 / 3e-142 SURFEIT 1, EMBRYO DEFECTIVE 3121, Surfeit locus 1 cytochrome c oxidase biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF14368 LTP_2 Probable lipid transfer
Representative CDS sequence
>Potri.003G113900.1 pacid=42784809 polypeptide=Potri.003G113900.1.p locus=Potri.003G113900 ID=Potri.003G113900.1.v4.1 annot-version=v4.1
ATGGAAAAGAAACACGAAATGGCATCTTCTGTCAAGATTTCTATGGTGGTGGTGATGGCAGTGGTCTTCTCTTCATGCACAACTACTTTAACAAAAGCAC
AAGAATCGTCTACATCTTGTGCAACTAAGTTAACAGCATGTCAAGCCTTCCTTGCCACCACAACCACTCCACCAGACAATTGCTGCAACCCCATCAAAGA
AGCAGTTGCAAAGGAGCTTCCTTGCCTTTGCAAACTCTATAATGACCCCAATTTGTTTCCGAGTCTTGGTATAAATGTCACTCAGGCTGTCAATCTCAGC
CAGAGATGCGGTGTCACCACGAATCTCACTAGTTGCGGTGCTTCAACTCCAACCGGCACGCCTCCAGGAGTTCCTGTAAAGGATGGTGGTGCTAGGATGG
CATGGACTGGGTTATCAGGATTGCTTGTCTTGTTGGCTGCTTCCCTCTTATATTAA
AA sequence
>Potri.003G113900.1 pacid=42784809 polypeptide=Potri.003G113900.1.p locus=Potri.003G113900 ID=Potri.003G113900.1.v4.1 annot-version=v4.1
MEKKHEMASSVKISMVVVMAVVFSSCTTTLTKAQESSTSCATKLTACQAFLATTTTPPDNCCNPIKEAVAKELPCLCKLYNDPNLFPSLGINVTQAVNLS
QRCGVTTNLTSCGASTPTGTPPGVPVKDGGARMAWTGLSGLLVLLAASLLY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G70250 receptor serine/threonine kina... Potri.003G113900
[exp]
0 1
AT1G67000 Protein kinase superfamily pro... Potri.008G125500
[exp]
3.74 0.7651
AT3G60470 Plant protein of unknown funct... Potri.014G053700
[exp]
7.07 0.7593
AT1G66890 unknown protein Potri.004G097200
[exp]
11.66 0.6953
AT2G44930 Plant protein of unknown funct... Potri.014G053900
[exp]
14.49 0.7340
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Potri.005G032800
[exp]
16.85 0.7344
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Potri.016G020800
[exp]
20.34 0.7431
AT5G60900 RLK1 receptor-like protein kinase 1... Potri.005G057000
[exp]
25.09 0.7186
AT1G54850 HSP20-like chaperones superfam... Potri.013G024600
[exp]
27.00 0.7205 HSP1.1
AT5G38280 PR5K PR5-like receptor kinase (.1) Potri.017G008800
[exp]
37.22 0.7175
AT3G63380 ATPase E1-E2 type family prote... Potri.005G052700
[exp]
51.65 0.6991

Potri.003G113900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.