Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPS15.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) AT1G07770 260 / 2e-91 RPS15A ribosomal protein S15A (.1.2) AT3G46040 256 / 5e-90 RPS15AD ribosomal protein S15A D (.1) AT2G39590 245 / 3e-85 Ribosomal protein S8 family protein (.1) AT4G29430 150 / 5e-48 RPS15AE ribosomal protein S15A E (.1) AT2G19720 145 / 6e-46 RPS15AB ribosomal protein S15A B (.1) ATCG00770 40 / 9e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208700 [exp] 267 / 3e-94 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 267 / 3e-94 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 264 / 5e-93 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.009G071250 [exp] 136 / 3e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 136 / 3e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023429 [exp] 260 / 3e-91 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10040309 [exp] 259 / 5e-91 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 259 / 5e-91 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 259 / 5e-91 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 259 / 5e-91 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 259 / 5e-91 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10040543 [exp] 138 / 3e-43 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10000975 [exp] 138 / 4e-43 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [poplar] [flax] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Potri.003G114800.1 pacid=42785802 polypeptide=Potri.003G114800.1.p locus=Potri.003G114800 ID=Potri.003G114800.1.v4.1 annot-version=v4.1 ATGGTGCGAGTTAGTGTTTTGAATGATGCTCTGAAGAGCATGTACAATGCTGAGAAACGTGGGAAGCGTCAGGTCATGATCAGGCCCTCCTCAAAGGTGA TCATCAAATTTCTGTTGGTGATGCAAAAGCATGGATACATTGGTGAATTTGAGTTTGTGGATGATCACAGGGCTGGTAAAATTGTGGTTGAATTGAATGG AAGATTGAACAAATGTGGAGTAATTAGTCCTCGTTTTGATGTGGGTGTCAAGGAGATTGAAACTTGGACTGCAAGGTTGCTCCCTTCAAGACAGTTTGGA TATATTGTCTTGACAACTTCTGCGGGCATTATGGACCATGAGGAGGCCAGAAGAAAGAATGTTGGTGGCAAAGTGCTTGGTTTCTTTTACTAG
AA sequence Show only first row Show all	>Potri.003G114800.1 pacid=42785802 polypeptide=Potri.003G114800.1.p locus=Potri.003G114800 ID=Potri.003G114800.1.v4.1 annot-version=v4.1 MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEFVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIETWTARLLPSRQFG YIVLTTSAGIMDHEEARRKNVGGKVLGFFY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59850			Ribosomal protein S8 family pr...		Potri.003G114800 [exp]	0	1	RPS15.1
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	1.00	0.9771
AT2G19740			Ribosomal protein L31e family ...		Potri.001G269600 [exp]	1.41	0.9770
AT4G25740			RNA binding Plectin/S10 domain...		Potri.005G040100 [exp]	2.82	0.9637
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.012G128300 [exp]	3.46	0.9663	Pt-RPS20.1
AT2G19730			Ribosomal L28e protein family ...		Potri.003G045500 [exp]	4.24	0.9685
AT2G19730			Ribosomal L28e protein family ...		Potri.001G194000 [exp]	4.24	0.9651
AT3G56340			Ribosomal protein S26e family ...		Potri.019G057000 [exp]	6.32	0.9659	RPS26.2
AT5G39850			Ribosomal protein S4 (.1)		Potri.007G056100 [exp]	7.34	0.9460
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.013G013600 [exp]	7.41	0.9612	RPL18.11
AT4G13170			Ribosomal protein L13 family p...		Potri.002G242600 [exp]	7.93	0.9637	Pt-RPL13.3

Compare expression of checked genes

Potri.003G114800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.