Potri.003G117200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60890 62 / 1e-13 ZPR2 LITTLE ZIPPER 2, protein binding (.1.2)
AT2G45450 49 / 3e-08 ZPR1 LITTLE ZIPPER 1, protein binding (.1)
AT3G52770 42 / 2e-06 ZPR3 LITTLE ZIPPER 3, protein binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G114900 181 / 8e-61 AT3G60890 57 / 1e-11 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.014G071200 68 / 4e-16 AT3G60890 62 / 1e-13 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.002G149600 65 / 7e-15 AT3G60890 65 / 1e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.006G083201 52 / 2e-09 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.010G237600 47 / 2e-08 AT3G52770 49 / 7e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.008G021766 42 / 3e-06 AT3G52770 51 / 1e-10 LITTLE ZIPPER 3, protein binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028902 119 / 2e-36 AT3G60890 59 / 1e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10008913 111 / 2e-33 AT3G60890 58 / 2e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10006673 95 / 1e-26 AT3G60890 47 / 4e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10007017 82 / 2e-21 AT3G60890 48 / 3e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10021375 51 / 2e-09 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10017055 51 / 2e-09 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10022725 49 / 6e-09 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1)
Lus10014188 48 / 2e-08 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence
>Potri.003G117200.2 pacid=42785702 polypeptide=Potri.003G117200.2.p locus=Potri.003G117200 ID=Potri.003G117200.2.v4.1 annot-version=v4.1
ATGTGCACTAACGGAGTAGACAGGATCCCTTCTCCTTTCCACCCTTCAAAGAGAAGGCAAAGATCAAAGAAATGTAAGGTTCAGGTTATTGGGCTCACCT
GCAGCAGGAGGTCAGGATATGAGGAATGGGAGGAGAAGAACATGGAGCTAAAGAACTTGAAGCTGTATTTAGAGAACCAAAGTATTGTTGAAGAGAACGA
GAAGCTGAGGAAGAAAGCTAGTCTTCTCCACCAAGAAAACCTGGCCTTAATGTCTGAACTTCAAAAGAAATTCCCTCATTTGGATCGCTTCTCCAACACC
CTACTTCTCTTACACAAACACTAG
AA sequence
>Potri.003G117200.2 pacid=42785702 polypeptide=Potri.003G117200.2.p locus=Potri.003G117200 ID=Potri.003G117200.2.v4.1 annot-version=v4.1
MCTNGVDRIPSPFHPSKRRQRSKKCKVQVIGLTCSRRSGYEEWEEKNMELKNLKLYLENQSIVEENEKLRKKASLLHQENLALMSELQKKFPHLDRFSNT
LLLLHKH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60890 ZPR2 LITTLE ZIPPER 2, protein bindi... Potri.003G117200 0 1
AT5G12235 CLE22 CLAVATA3/ESR-RELATED 22 (.1) Potri.006G036700 6.78 0.8211
AT2G28315 Nucleotide/sugar transporter f... Potri.009G011100 13.82 0.8718
AT3G45850 P-loop containing nucleoside t... Potri.009G026000 18.00 0.8715
AT1G52150 HD ATHB15, ICU4, C... INCURVATA 4, CORONA, Homeobox-... Potri.001G188800 27.12 0.8322 ATHB.12
AT4G27270 Quinone reductase family prote... Potri.001G410700 30.91 0.8490 Pt-FQR1.1
AT4G27270 Quinone reductase family prote... Potri.004G028900 36.74 0.8413
AT1G79820 SGB1 SUPPRESSOR OF G PROTEIN BETA1,... Potri.001G185300 39.59 0.8267
AT1G04430 S-adenosyl-L-methionine-depend... Potri.002G036800 48.09 0.8296
AT5G26910 unknown protein Potri.013G010500 54.54 0.8252
AT4G10550 Subtilase family protein (.1.2... Potri.001G455800 61.50 0.7585

Potri.003G117200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.