Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45680 131 / 2e-38 TCP TCP9 TCP family transcription factor (.1) AT5G51910 125 / 2e-36 TCP TCP19 TCP family transcription factor (.1.2) AT1G69690 117 / 6e-33 TCP AtTCP15, TCP15 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) AT3G27010 113 / 1e-31 TCP ATTCP20, PCF1, AT-TCP20 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) AT3G47620 114 / 4e-31 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) AT1G58100 112 / 2e-30 TCP TCP8 TCP domain protein 8, TCP family transcription factor (.1.2) AT1G72010 111 / 2e-30 TCP TCP22 TCP family transcription factor (.1) AT1G35560 107 / 6e-29 TCP TCP23 TCP family transcription factor (.1) AT5G08330 103 / 1e-28 TCP AtTCP11, CHE, TCP21 TCP domain protein 11, TCP family transcription factor (.1) AT5G23280 102 / 5e-28 TCP TCP7 TCP family transcription factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G111800 [exp] 140 / 2e-41 AT2G45680 169 / 8e-49 TCP family transcription factor (.1) Potri.002G152200 [exp] 137 / 1e-40 AT2G45680 286 / 6e-95 TCP family transcription factor (.1) Potri.014G078500 [exp] 136 / 2e-40 AT2G45680 257 / 1e-83 TCP family transcription factor (.1) Potri.015G138200 [exp] 126 / 4e-36 AT5G51910 230 / 1e-73 TCP family transcription factor (.1.2) Potri.012G135900 [exp] 122 / 1e-34 AT5G51910 219 / 1e-69 TCP family transcription factor (.1.2) Potri.017G068748 [exp] 115 / 2e-32 AT3G27010 231 / 3e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.001G327100 [exp] 115 / 2e-32 AT3G27010 230 / 6e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.001G060000 [exp] 114 / 3e-32 AT3G27010 215 / 2e-68 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.003G167900 [exp] 112 / 3e-31 AT3G27010 212 / 3e-67 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032022 [exp] 117 / 5e-33 AT3G27010 234 / 2e-75 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10037046 [exp] 110 / 1e-32 AT3G27010 145 / 5e-44 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10037190 [exp] 116 / 8e-32 AT1G69690 172 / 9e-50 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) Lus10015760 [exp] 112 / 1e-31 AT3G27010 181 / 1e-55 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10010177 [exp] 104 / 4e-28 AT5G23280 186 / 1e-57 TCP family transcription factor (.1) Lus10013814 [exp] 95 / 2e-25 AT3G47620 119 / 2e-32 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10041328 [exp] 88 / 1e-22 AT3G47620 93 / 3e-22 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10035193 [exp] 78 / 9e-19 AT3G27010 156 / 6e-47 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10008621 [exp] 77 / 4e-18 AT3G47620 140 / 4e-38 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10008444 [exp] 56 / 1e-11 AT1G58100 104 / 5e-28 TCP domain protein 8, TCP family transcription factor (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03634 [poplar] [flax] TCP TCP family transcription factor
Representative CDS sequence Show only first row Show all	>Potri.003G120201.1 pacid=42784794 polypeptide=Potri.003G120201.1.p locus=Potri.003G120201 ID=Potri.003G120201.1.v4.1 annot-version=v4.1 ATGGGTGTAGTCCCGCTAGCTATGCAGATGCCGATGCCAATGTCAATTCCAATGCCTATGCCAGTCACTACAATAGCAACAATCAGACGTTCATCCACCA AAGACCGCCACACAAAAGTGGAAGGCCGTGGTCGTAGGATCCGAATACCCGCCACCTGTTCTGCCCGGATCTTCCAATTGACTCGAGAATTAGGCCACAG TTCAGACGGCGAAACCGTTAGATGGCTCCTTGAACATGCTGAACAAGCTATTATTGAAGCTACCGGCACGGGCACGGTTCTTGCTATTGCTGTGGAGGGG CTCTCAAAATCCGTACAGCAGCCACTAACAACAGCAATTCATTAA
AA sequence Show only first row Show all	>Potri.003G120201.1 pacid=42784794 polypeptide=Potri.003G120201.1.p locus=Potri.003G120201 ID=Potri.003G120201.1.v4.1 annot-version=v4.1 MGVVPLAMQMPMPMSIPMPMPVTTIATIRRSSTKDRHTKVEGRGRRIRIPATCSARIFQLTRELGHSSDGETVRWLLEHAEQAIIEATGTGTVLAIAVEG LSKSVQQPLTTAIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45680	TCP	TCP9	TCP family transcription facto...		Potri.003G120201 [exp]	0	1
AT4G03220			Protein with RNI-like/FBD-like...		Potri.015G002100 [exp]	1.41	0.9184
AT2G32600			hydroxyproline-rich glycoprote...		Potri.016G097600 [exp]	4.47	0.8943
					Potri.006G239650 [exp]	7.48	0.8992
AT3G55730	MYB	ATMYB109	myb domain protein 109 (.1)		Potri.008G062700 [exp]	9.64	0.8604
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.013G104100 [exp]	9.89	0.8782
					Potri.013G048150 [exp]	10.09	0.8747
AT4G38170		FRS9	FAR1-related sequence 9 (.1)		Potri.004G209100 [exp]	10.48	0.8680
AT2G31600			unknown protein		Potri.017G035200 [exp]	13.00	0.8785
AT5G62640		AtELF5, ELF5	EARLY FLOWERING 5, proline-ric...		Potri.015G090200 [exp]	14.69	0.8912	ELF5.2
AT4G31200			SWAP (Suppressor-of-White-APri...		Potri.006G279800 [exp]	18.33	0.8764

Compare expression of checked genes

Potri.003G120201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.