Potri.003G121500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52060 243 / 8e-79 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G62100 217 / 2e-69 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G07220 212 / 3e-67 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT3G51780 146 / 3e-42 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G14360 91 / 5e-22 Ubiquitin-like superfamily protein (.1)
AT5G40630 87 / 8e-21 Ubiquitin-like superfamily protein (.1)
AT2G30105 42 / 0.0005 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G110300 471 / 4e-168 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.015G135500 271 / 2e-89 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 257 / 3e-84 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 180 / 2e-55 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.009G074300 166 / 6e-50 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 166 / 1e-49 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.016G121200 103 / 7e-26 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Potri.001G339100 89 / 2e-21 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027420 262 / 2e-86 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10038882 255 / 7e-84 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 252 / 1e-82 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10006328 246 / 3e-81 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
Lus10029598 243 / 9e-80 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Lus10005772 215 / 5e-68 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10023279 177 / 2e-54 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10005051 130 / 9e-35 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027822 125 / 2e-33 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10003393 86 / 3e-19 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF02179 BAG BAG domain
Representative CDS sequence
>Potri.003G121500.1 pacid=42784580 polypeptide=Potri.003G121500.1.p locus=Potri.003G121500 ID=Potri.003G121500.1.v4.1 annot-version=v4.1
ATGGAACCAATGAAGTCAAAGATTAAGGGGATGTTTACTCAGCGGGGTAAGGAGGACTTTTTTGTTGGCAGAGGCAATATGAATTTTGTTGAAGAATGGG
AAATTAGGCCAGGAGGAATGTTAGTTCAAAAGAGAACTACTGCTGATTCCAATCACAACTCTGTTCCTGTTTCCAACATTAAAGTTAGAGTCAAATATGG
TTCTTTATGTCATGAAATCAGTATCAGTTCTCAAGCAAGTTTTGGTGAACTGAAAAAAATGCTAGCGGAACATACAGGAGTGCACCCTCTGGATCAAAAG
CTGATATTCAAGAAGAAGGAGAGAAATTCGAAGGCGTATTTAGATGTTGCTGGAGTGAAAGATGGATCCAAAATTGTGTTAATTGAGGACATTACCAGCC
GCGAAAGGCGTTGTCTTGAGATGCTCAAATCTGCTAAGATAGAAAAGGGTTCGAAGTCATTGCAACAAGTAAGCTTGGAAGTTGACCAGTTTGGTGATAA
GGTGACATCCTTGGAAACAACAACTTCCAAAGGAGGAAAAGTAGCAGAGAAAGACGTGGATGGTTTGACTGAAATCTTGATGGCAAAATTAGTAGCATTG
GATGGGATTTTTGTTGAGGGAGACTTGAAGTTGCAGAAGAGAATGCAGGAAAGGAAAGTTCAGCAGTACATTGAAGCTCTTGATAGGCTCAAGTTAAACT
ATTCTACTGCCAATACCAGTGGAGGCAAAATCCCATTGCAGCAACAAGATAATTCAACTGGGAAAATGCCAATACCAAAGCAAAAACAGTCAGTTCAGTC
CAAACAGCAGAATGCTACAATGCAAATGCCAACACAGAAGCAGCAGCGACCAGTATTGAGTAATTCCGAGTCTTTTGTGGTCACAACAGCATGGGAAACT
TTTGATTAA
AA sequence
>Potri.003G121500.1 pacid=42784580 polypeptide=Potri.003G121500.1.p locus=Potri.003G121500 ID=Potri.003G121500.1.v4.1 annot-version=v4.1
MEPMKSKIKGMFTQRGKEDFFVGRGNMNFVEEWEIRPGGMLVQKRTTADSNHNSVPVSNIKVRVKYGSLCHEISISSQASFGELKKMLAEHTGVHPLDQK
LIFKKKERNSKAYLDVAGVKDGSKIVLIEDITSRERRCLEMLKSAKIEKGSKSLQQVSLEVDQFGDKVTSLETTTSKGGKVAEKDVDGLTEILMAKLVAL
DGIFVEGDLKLQKRMQERKVQQYIEALDRLKLNYSTANTSGGKIPLQQQDNSTGKMPIPKQKQSVQSKQQNATMQMPTQKQQRPVLSNSESFVVTTAWET
FD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Potri.003G121500 0 1
AT4G05030 Copper transport protein famil... Potri.006G001900 2.64 0.8863
Potri.015G025600 5.65 0.8828
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Potri.003G193400 12.48 0.8695
AT5G45540 Protein of unknown function (D... Potri.001G146800 16.70 0.8555
AT1G17100 SOUL heme-binding family prote... Potri.012G088400 17.66 0.8611
Potri.010G219300 18.89 0.8697
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Potri.010G080900 21.72 0.7716 Pt-CAM8.1
AT4G13830 J20 DNAJ-like 20 (.1.2) Potri.007G088900 24.24 0.8622
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Potri.007G037300 25.39 0.8670
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.007G002400 26.49 0.8628

Potri.003G121500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.