Potri.003G122000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G109700 269 / 4e-93 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.006G134900 62 / 2e-12 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.009G083500 60 / 2e-11 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.003G086600 50 / 1e-07 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 45 / 6e-06 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017040 64 / 7e-13 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 63 / 2e-12 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 56 / 8e-10 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 53 / 1e-08 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 52 / 2e-08 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037793 48 / 1e-06 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017076 46 / 2e-06 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017077 46 / 3e-06 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10040145 44 / 1e-05 ND 40 / 4e-04
Lus10000961 43 / 4e-05 ND 39 / 5e-04
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.003G122000.1 pacid=42784783 polypeptide=Potri.003G122000.1.p locus=Potri.003G122000 ID=Potri.003G122000.1.v4.1 annot-version=v4.1
ATGGCCCCTTCTTTATTCCTTGTACTTGTACTACTCATCTCAACAAGCCAATGTTCTGCAACTCTGCAAGATAAACAACCTGATCTAATAGAGAAATCCT
GCTCAATAATCGTAGGATATGAAGACTGCGTGAGAATCCTCAGATCAGACCCTCGTGCCATTAAAGCAACCAACGTCAAAGAGCTAGCTTACATCATTCT
TGATCTCTGCATAGCGAACGCCACAGAGACTCTTCGAGAAATCCCAAAGTTGCAAGAGAAGTACAAGAAAGATGGACAAATTGAGGAAGCTCTACGAAGG
TGTGCCGTGGAATATGAGAGTGCTGACAAAGTTTATTTTCGCAAGGCTGTTGAGCAACTAGGGACTAAGTCTTATCGTGAAGCACAGAATTCAGCACACG
TCGGAGGTGCATTAGGTACGAGTTGTGAACAAGAATTTTATTTCCAGGCACCAGAATTCTCACCTTTATGGCTCAGGAATCATGATTTGGCAGTTCTTGG
TACTGTTGCAGAAGGCATTGTTTCCCTTCTTCGTTTGAATAAATCTTAA
AA sequence
>Potri.003G122000.1 pacid=42784783 polypeptide=Potri.003G122000.1.p locus=Potri.003G122000 ID=Potri.003G122000.1.v4.1 annot-version=v4.1
MAPSLFLVLVLLISTSQCSATLQDKQPDLIEKSCSIIVGYEDCVRILRSDPRAIKATNVKELAYIILDLCIANATETLREIPKLQEKYKKDGQIEEALRR
CAVEYESADKVYFRKAVEQLGTKSYREAQNSAHVGGALGTSCEQEFYFQAPEFSPLWLRNHDLAVLGTVAEGIVSLLRLNKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Potri.003G122000 0 1
AT3G51860 CAX1-LIKE, ATHC... cation exchanger 3 (.1) Potri.016G115500 1.00 0.9576 CAX3.2
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Potri.014G122700 1.41 0.9557
AT4G24700 unknown protein Potri.012G086300 4.89 0.9145
AT5G19040 ATIPT5 Arabidopsis thaliana ISOPENTEN... Potri.008G202200 7.54 0.8498
ATCG00220 ATCG00220.1, PS... photosystem II reaction center... Potri.013G142100 8.00 0.8994
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Potri.003G138400 13.03 0.8972
AT1G54570 Esterase/lipase/thioesterase f... Potri.005G046700 15.42 0.8998
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.008G165600 16.37 0.8449
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G158200 27.00 0.8721 Elip1,Pt-ELIP2.2
AT4G18960 MADS AG AGAMOUS, K-box region and MADS... Potri.004G064300 27.49 0.8716

Potri.003G122000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.