Potri.003G123101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53020 218 / 1e-73 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 218 / 1e-73 RPL24A ribosomal protein L24 (.1)
AT2G44860 72 / 2e-16 Ribosomal protein L24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G141900 230 / 2e-78 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.004G085300 230 / 2e-78 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 229 / 4e-78 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 229 / 4e-78 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.009G148500 76 / 9e-18 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 76 / 1e-17 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024560 226 / 1e-76 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10032198 225 / 2e-76 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10008640 221 / 1e-74 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10035584 220 / 2e-74 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10006314 217 / 3e-72 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 216 / 5e-72 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Lus10014637 105 / 9e-30 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1)
Lus10020552 81 / 9e-20 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Potri.003G123101.1 pacid=42786951 polypeptide=Potri.003G123101.1.p locus=Potri.003G123101 ID=Potri.003G123101.1.v4.1 annot-version=v4.1
ATGGTTCTCAAGACTGAGCTTTGCCGCTTCAGTGGTGCCAAGATTTACCCTGGTAAGGGTATCAGATTTATTCGTTCCGATTCTCAGGTTTTCCTCTTTG
CCAACTCGAAATGCAAGAGGTATTTCCACAATCGCCTTAAGCCTTCCAAGCTTACCTGGACAGCCATGTACAGGAAACAGCACAAGAAGGACATTGCTGC
TGAGGCTGTTAAGAAGAAGCGCCGAACCACTAAGAAGCCCTACTCGAGATCTATAGTTGGTGCTACTTTGGAAGTCATACAGAAGAGGAGAGCTGAGAAG
CCTGAGGTCCGTGATGCAGCTCGTGAAGCTGCTCTACGTGAAATCAAGGAGAGAATCAAGAAAACCAAGGATGAAAAGAAGGCGAAGAAAGCAGAGTCGA
TGGCAAAGACACAGAAGACACAAACCAAGGGTGGGCCTAAGGGCGCTGGACCTAAGGGCCCTAAGCTTGGTGGCGGCGGTGGAAAGCGATGA
AA sequence
>Potri.003G123101.1 pacid=42786951 polypeptide=Potri.003G123101.1.p locus=Potri.003G123101 ID=Potri.003G123101.1.v4.1 annot-version=v4.1
MVLKTELCRFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQHKKDIAAEAVKKKRRTTKKPYSRSIVGATLEVIQKRRAEK
PEVRDAAREAALREIKERIKKTKDEKKAKKAESMAKTQKTQTKGGPKGAGPKGPKLGGGGGKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.003G123101 0 1
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.004G085300 1.73 0.9734 RPL24.1
AT4G14320 Zinc-binding ribosomal protein... Potri.005G092500 2.00 0.9759
AT2G39390 Ribosomal L29 family protein ... Potri.006G214100 4.24 0.9690
AT2G27710 60S acidic ribosomal protein f... Potri.004G185800 4.47 0.9710
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.014G127300 4.47 0.9743 RPL18.10
AT4G16720 Ribosomal protein L23/L15e fam... Potri.001G156100 5.65 0.9714 RPL15.3
AT1G15250 Zinc-binding ribosomal protein... Potri.018G036900 6.32 0.9656
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Potri.005G080700 6.70 0.9657
AT5G15610 Proteasome component (PCI) dom... Potri.004G116700 7.74 0.9566
AT5G24510 60S acidic ribosomal protein f... Potri.014G105400 9.79 0.9603

Potri.003G123101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.