Potri.003G123500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47670 140 / 1e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G53840 126 / 3e-33 ATPME1 pectin methylesterase 1 (.1)
AT3G14300 126 / 4e-33 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
AT2G01610 90 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 88 / 4e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G04960 78 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G25250 74 / 4e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G10710 74 / 4e-15 RHS12 root hair specific 12 (.1)
AT1G23205 70 / 3e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 69 / 3e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G108200 341 / 6e-120 AT3G47670 122 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G072700 172 / 5e-50 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1)
Potri.001G162700 150 / 4e-42 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1)
Potri.006G134800 95 / 3e-22 AT1G53840 505 / 1e-173 pectin methylesterase 1 (.1)
Potri.008G132600 87 / 1e-20 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 84 / 1e-19 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 78 / 1e-17 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 77 / 7e-17 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 75 / 3e-16 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008625 142 / 2e-41 AT3G47670 146 / 8e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037457 137 / 6e-39 AT1G53840 234 / 1e-72 pectin methylesterase 1 (.1)
Lus10042193 135 / 5e-36 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Lus10003934 133 / 1e-35 AT3G14300 663 / 0.0 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Lus10031138 91 / 5e-22 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 86 / 2e-20 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10034859 89 / 6e-20 AT3G10710 561 / 0.0 root hair specific 12 (.1)
Lus10033399 87 / 2e-19 AT3G10710 606 / 0.0 root hair specific 12 (.1)
Lus10031132 81 / 2e-18 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 80 / 6e-18 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.003G123500.1 pacid=42784768 polypeptide=Potri.003G123500.1.p locus=Potri.003G123500 ID=Potri.003G123500.1.v4.1 annot-version=v4.1
ATGGAATCCCTTAACTTTTTCAAAGGCTATGGCAAAGTGAATCCGCTTGAAGATCAAAGCCCTCACCAACAGGAAAGTACTGCATCAAAACGCCGAATCC
TCATCATCAGCGTTTCATCCATCCTCTTTTTTACTCTAATCCTCGGTCTAGCCCTTGCAGCATTGATCCATGAGTCAAATACCGAGCCAGACGAATTCCC
ATATCTCTCTTCATCAAACTCAGCTGAGTCAATCAAAACAGTCTGTGACATGACTCTGTATCCATCCTCCTGCTTCACCAGCATATCCTCTCTTAACATT
TCAACAAAACCTGACCCAGAAGTCATCTTCAAGCTCTCTCTCAAAGTCTCCATTACAGAGCTCAAATACCTCTCTTCTTTATTCACTAGTTCACATGATG
TTAACTCTCAGGCTGCTATGAGAGATTGCGTGAGCCTGTTTGATGATTCCTTGGGTAAGCTCAACGATTCTTTGTTGGCAATGGAGGTTGGACCTGGAGA
GAAGATGTTGACTTTGGAAAAAGTGAACGACATCCATACGTGGATCAGTGCTGCCATGACAGATCAAGATACTTGCATAGACGGTTTGGAGGAGATGGAA
TCGGTGTTACCTGATGAGATCAAGGCCAAGGTGGAGAGGACTAAGGATTTCTTGAGCATTAGCTTGGCTATCATTGCTAAGATGGAAGCTCTTCTTAAAA
AATTTGATCTCGAAATGCATTGA
AA sequence
>Potri.003G123500.1 pacid=42784768 polypeptide=Potri.003G123500.1.p locus=Potri.003G123500 ID=Potri.003G123500.1.v4.1 annot-version=v4.1
MESLNFFKGYGKVNPLEDQSPHQQESTASKRRILIISVSSILFFTLILGLALAALIHESNTEPDEFPYLSSSNSAESIKTVCDMTLYPSSCFTSISSLNI
STKPDPEVIFKLSLKVSITELKYLSSLFTSSHDVNSQAAMRDCVSLFDDSLGKLNDSLLAMEVGPGEKMLTLEKVNDIHTWISAAMTDQDTCIDGLEEME
SVLPDEIKAKVERTKDFLSISLAIIAKMEALLKKFDLEMH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G47670 Plant invertase/pectin methyle... Potri.003G123500 0 1
AT5G07250 ATRBL3 RHOMBOID-like protein 3 (.1.2) Potri.012G139600 6.32 0.6222
AT5G52280 Myosin heavy chain-related pro... Potri.012G141200 14.14 0.6703
AT5G06680 ATSPC98, SPC98,... ARABIDOPSIS THALIANA GAMMA TUB... Potri.006G194200 20.85 0.5529
AT1G59640 bHLH ZCW32, bHLH031... BIG PETAL UB, BIG PETAL P (.1.... Potri.008G190800 24.26 0.5700
AT1G79720 Eukaryotic aspartyl protease f... Potri.003G185175 28.10 0.5856
AT1G55210 Disease resistance-responsive ... Potri.003G216300 28.30 0.5871
AT4G34880 Amidase family protein (.1) Potri.009G130500 40.69 0.5835
AT1G60590 Pectin lyase-like superfamily ... Potri.010G042100 44.27 0.5530
AT5G14980 alpha/beta-Hydrolases superfam... Potri.001G466700 45.00 0.5316
AT2G25790 Leucine-rich receptor-like pro... Potri.006G237400 64.80 0.5523

Potri.003G123500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.