Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63245 36 / 0.0003 CLE14 CLAVATA3/ESR-RELATED 14 (.1) AT1G68795 37 / 0.0005 CLE12 CLAVATA3/ESR-RELATED 12 (.1) AT1G26600 36 / 0.0009 CLE9 CLAVATA3/ESR-RELATED 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G107400 [exp] 87 / 6e-24 ND / Potri.002G228000 [exp] 57 / 3e-12 AT1G63245 44 / 3e-07 CLAVATA3/ESR-RELATED 14 (.1) Potri.015G139900 [exp] 40 / 9e-06 AT1G63245 44 / 3e-07 CLAVATA3/ESR-RELATED 14 (.1) Potri.012G138100 [exp] 39 / 3e-05 AT1G63245 41 / 4e-06 CLAVATA3/ESR-RELATED 14 (.1) Potri.010G160600 [exp] 39 / 0.0001 AT1G69320 48 / 1e-07 CLAVATA3/ESR-RELATED 10 (.1) Potri.012G138200 [exp] 37 / 0.0001 ND / Potri.008G093500 [exp] 36 / 0.0005 AT1G69320 62 / 1e-13 CLAVATA3/ESR-RELATED 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008016 [exp] 39 / 5e-05 ND 40 / 2e-05
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G124000.1 pacid=42786132 polypeptide=Potri.003G124000.1.p locus=Potri.003G124000 ID=Potri.003G124000.1.v4.1 annot-version=v4.1 ATGAGGATTAATCCAAATCCAAGACTCTCATTTATTTTCTTGATCATCATCATCCTTGCTATTAGCCAGCTCTCAAGTTGCCGCCGCCTCCATATAAAAA TAGGTGATCAAAATAAGCAAAGAGCTGAGGCAGATGTGTTTACTCAGCTTTCATGGCATTTCCCTGCAAAAGCTTCTGAAGGATCAAGCAAAGATGAGAT CGACGACCCAGTTTATGGAGTTTCTTATAGAGCAGTTCCAGGGGGGCCAAACCCACTTCATAACTGA
AA sequence Show only first row Show all	>Potri.003G124000.1 pacid=42786132 polypeptide=Potri.003G124000.1.p locus=Potri.003G124000 ID=Potri.003G124000.1.v4.1 annot-version=v4.1 MRINPNPRLSFIFLIIIILAISQLSSCRRLHIKIGDQNKQRAEADVFTQLSWHFPAKASEGSSKDEIDDPVYGVSYRAVPGGPNPLHN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.003G124000 [exp]	0	1
AT1G59590		ZCF37	ZCF37 (.1)		Potri.002G118200 [exp]	4.89	0.8516	ZCF37.1
AT1G22170			Phosphoglycerate mutase family...		Potri.005G168000 [exp]	8.83	0.8598
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Potri.007G002100 [exp]	16.21	0.8667
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Potri.011G048100 [exp]	24.37	0.8601
AT1G78770		APC6	anaphase promoting complex 6 (...		Potri.001G389500 [exp]	26.15	0.8444
AT3G18230			Octicosapeptide/Phox/Bem1p fam...		Potri.012G053500 [exp]	42.53	0.8471
AT1G06840			Leucine-rich repeat protein ki...		Potri.019G131800 [exp]	48.98	0.8334
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Potri.019G003200 [exp]	51.38	0.8033
AT5G45490			P-loop containing nucleoside t...		Potri.011G040800 [exp]	61.43	0.8055
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Potri.001G364600 [exp]	66.06	0.8072

Compare expression of checked genes

Potri.003G124000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.