Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23750 130 / 4e-38 Remorin family protein (.1.2) AT3G48940 114 / 2e-32 Remorin family protein (.1) AT3G61260 107 / 3e-29 Remorin family protein (.1) AT2G45820 100 / 1e-26 Remorin family protein (.1) AT1G63295 68 / 1e-14 Remorin family protein (.1) AT4G00670 60 / 7e-12 Remorin family protein (.1) AT2G02170 41 / 0.0002 Remorin family protein (.1.2) AT1G67590 40 / 0.0005 Remorin family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G107000 [exp] 182 / 9e-59 AT5G23750 55 / 2e-09 Remorin family protein (.1.2) Potri.015G143600 [exp] 131 / 2e-38 AT5G23750 111 / 1e-30 Remorin family protein (.1.2) Potri.014G081300 [exp] 130 / 2e-38 AT3G61260 199 / 4e-65 Remorin family protein (.1) Potri.002G157700 [exp] 128 / 2e-37 AT3G61260 167 / 2e-52 Remorin family protein (.1) Potri.012G140800 [exp] 108 / 2e-29 AT5G23750 98 / 2e-25 Remorin family protein (.1.2) Potri.012G140900 [exp] 54 / 2e-09 AT3G48940 78 / 6e-19 Remorin family protein (.1) Potri.006G053200 [exp] 42 / 0.0001 AT3G57540 196 / 2e-61 Remorin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039215 [exp] 133 / 2e-39 AT3G61260 196 / 7e-64 Remorin family protein (.1) Lus10027460 [exp] 129 / 1e-37 AT3G61260 192 / 2e-62 Remorin family protein (.1) Lus10018840 [exp] 123 / 2e-35 AT3G61260 206 / 1e-67 Remorin family protein (.1) Lus10001477 [exp] 117 / 7e-33 AT5G23750 162 / 3e-50 Remorin family protein (.1.2) Lus10017811 [exp] 115 / 3e-32 AT3G61260 199 / 5e-65 Remorin family protein (.1) Lus10008014 [exp] 112 / 5e-32 AT5G23750 158 / 5e-50 Remorin family protein (.1.2) Lus10014785 [exp] 112 / 3e-31 AT3G61260 177 / 1e-56 Remorin family protein (.1) Lus10008477 [exp] 111 / 2e-30 AT5G23750 154 / 5e-47 Remorin family protein (.1.2) Lus10030379 [exp] 97 / 2e-25 AT3G61260 178 / 4e-57 Remorin family protein (.1) Lus10024514 [exp] 61 / 8e-12 AT5G23750 113 / 5e-32 Remorin family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03763 [poplar] [flax] Remorin_C Remorin, C-terminal region
Representative CDS sequence Show only first row Show all	>Potri.003G124400.1 pacid=42787464 polypeptide=Potri.003G124400.1.p locus=Potri.003G124400 ID=Potri.003G124400.1.v4.1 annot-version=v4.1 ATGGGGGAGGAGGAGCACGAGAAAGCTGAATCTAAGGCAGTCTCTCTGCCTACACCAGCTAAAGAGCATGGACCTGTTAAAGAAGAGAAAGAAGCCTCTT TAAATGATGCTGCTAATGAGAAGAACTTGGTCCCAGTTTCTGAAAATGCTGCAGATACAACTGCTGCTGAAAACGTTTCAGGGGGATCGAATAACAGAGA TATAATCCTTTCAAGGGTTGAAACGGAGAAAAGATATGCTCTAATTAAAGCATGGGTAGAAAATGAGAAGGCTAAAGTGGAGAACAAGGCTCACAAAAAA CTCTCTGCCATTGGATCATGGGAGACAACCAAGAAAGTATCGGTGGAGGCAAAAATAATGAAGTTTGAGGAAAAACTGGAAAGGAAGAAGGCTGAATATG AAGAGAAAATGAAGAACAAAGCAGCCGAACTCCACAAGGCAGCTGAAGAGAAGAAAGCAATGATTGAAGCGAAAAAAAGCGAAGAATGTCTCAAGGTAGA GGAAACCGCGGCGAAATTCCGAGCAACCGGGTATACACCAAAGAAGTTTCTTGGATGCTTTAGTAGCTAA
AA sequence Show only first row Show all	>Potri.003G124400.1 pacid=42787464 polypeptide=Potri.003G124400.1.p locus=Potri.003G124400 ID=Potri.003G124400.1.v4.1 annot-version=v4.1 MGEEEHEKAESKAVSLPTPAKEHGPVKEEKEASLNDAANEKNLVPVSENAADTTAAENVSGGSNNRDIILSRVETEKRYALIKAWVENEKAKVENKAHKK LSAIGSWETTKKVSVEAKIMKFEEKLERKKAEYEEKMKNKAAELHKAAEEKKAMIEAKKSEECLKVEETAAKFRATGYTPKKFLGCFSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G23750			Remorin family protein (.1.2)		Potri.003G124400 [exp]	0	1
AT4G12350	MYB	ATMYB42	myb domain protein 42 (.1)		Potri.003G114100 [exp]	1.73	0.9014	MYB85.1
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.016G006900 [exp]	2.00	0.8917
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.006G018000 [exp]	4.47	0.8837
AT1G13340			Regulator of Vps4 activity in ...		Potri.010G127000 [exp]	5.47	0.8705
AT5G04700			Ankyrin repeat family protein ...		Potri.002G048666 [exp]	6.48	0.8258
AT5G15790			RING/U-box superfamily protein...		Potri.017G100100 [exp]	7.00	0.8671
AT5G07220		ATBAG3	BCL-2-associated athanogene 3 ...		Potri.001G358200 [exp]	10.58	0.8384
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092932 [exp]	10.90	0.8372
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.013G156200 [exp]	14.42	0.8432
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Potri.011G167532 [exp]	17.14	0.7394

Compare expression of checked genes

Potri.003G124400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.