Plant FIBer expression Database

Potri.003G126001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G105300
[exp]
61 / 1e-12 AT1G63450 653 / 0.0 root hair specific 8 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000604
[exp]
64 / 2e-13 AT1G63450 625 / 0.0 root hair specific 8 (.1)
PFAM info
Representative CDS sequence
>Potri.003G126001.1 pacid=42786346 polypeptide=Potri.003G126001.1.p locus=Potri.003G126001 ID=Potri.003G126001.1.v4.1 annot-version=v4.1
ATGACATGTTTCCGTCAAAAAGTCCAGAAGAATTGTATTTGCCGATGTGTTCATTGTTATGGAAATTGCATCCTCAAACCGAGAACTCGAATCACCATAC
ACCAACTCAGGCAGTACTTCATACACTACGTACCTCCTCATATCCTCTCTTTCCCTCGCAGAAATACTGCTCAGCCTCTCCACCGCGTTCACCTTCATTT
GCCTCACTTCTTCTTGGTCTATGAACTCTGA
AA sequence
>Potri.003G126001.1 pacid=42786346 polypeptide=Potri.003G126001.1.p locus=Potri.003G126001 ID=Potri.003G126001.1.v4.1 annot-version=v4.1
MTCFRQKVQKNCICRCVHCYGNCILKPRTRITIHQLRQYFIHYVPPHILSFPRRNTAQPLHRVHLHLPHFFLVYEL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G63450 RHS8 root hair specific 8 (.1) Potri.003G126001
[exp]
0 1
Potri.001G132850
[exp]
9.79 0.6886
AT3G60740 TFCD, EMB133, C... TITAN 1, TUBULIN FOLDING COFAC... Potri.002G145750
[exp]
11.40 0.6284
Potri.010G080501
[exp]
20.83 0.6553
AT1G52520 FAR1_related FRS6 FAR1-related sequence 6 (.1) Potri.003G031500
[exp]
32.86 0.6768
AT5G67470 ATFH6 ARABIDOPSIS FORMIN HOMOLOG 6, ... Potri.007G054900
[exp]
38.72 0.6157
Potri.003G010664
[exp]
43.37 0.6346
AT4G38210 ATHEXPALPHA1.23... EXPANSIN 20, expansin A20 (.1) Potri.009G169500
[exp]
68.01 0.6196 PtrEXPA21,ATEXPA20.1
AT3G23000 PKS7, ATSRPK1, ... SNF1-RELATED PROTEIN KINASE 3.... Potri.008G160200
[exp]
75.11 0.5959 CIPK4.1
AT4G33625 unknown protein Potri.007G115800
[exp]
78.42 0.5920
AT5G33320 ARAPPT, CUE1 PHOSPHOENOLPYRUVATE/PHOSPHATE ... Potri.012G082100
[exp]
87.90 0.5221

Potri.003G126001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.