Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11560 207 / 5e-64 bromo-adjacent homology (BAH) domain-containing protein (.1) AT4G23120 144 / 9e-42 Bromo-adjacent homology (BAH) domain-containing protein (.1) AT2G25120 136 / 1e-38 Bromo-adjacent homology (BAH) domain-containing protein (.1) AT3G43990 135 / 2e-38 Bromo-adjacent homology (BAH) domain-containing protein (.1) AT3G48060 64 / 5e-12 BAH domain ;TFIIS helical bundle-like domain (.1) AT3G48050 64 / 5e-12 SUO 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G104300 [exp] 228 / 1e-71 AT4G11560 607 / 0.0 bromo-adjacent homology (BAH) domain-containing protein (.1) Potri.003G127400 [exp] 221 / 3e-69 AT4G11560 609 / 0.0 bromo-adjacent homology (BAH) domain-containing protein (.1) Potri.015G072900 [exp] 65 / 3e-12 AT3G48050 1311 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2) Potri.015G072800 [exp] 64 / 5e-12 AT3G48050 1343 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2) Potri.012G077700 [exp] 62 / 4e-11 AT3G48050 1343 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2) Potri.012G077500 [exp] 59 / 3e-10 AT3G48050 1375 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2) Potri.002G226000 [exp] 42 / 9e-05 AT4G22140 379 / 2e-135 EARLY BOLTING IN SHORT DAYS, PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein (.1), PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008527 [exp] 207 / 1e-63 AT4G11560 596 / 0.0 bromo-adjacent homology (BAH) domain-containing protein (.1) Lus10008492 [exp] 205 / 5e-63 AT4G11560 609 / 0.0 bromo-adjacent homology (BAH) domain-containing protein (.1) Lus10033410 [exp] 64 / 7e-12 AT3G48060 726 / 0.0 BAH domain ;TFIIS helical bundle-like domain (.1) Lus10042137 [exp] 63 / 2e-11 AT3G48050 764 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2) Lus10020020 [exp] 42 / 0.0001 AT4G22140 375 / 7e-134 EARLY BOLTING IN SHORT DAYS, PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein (.1), PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01426 [poplar] [flax] BAH BAH domain
Representative CDS sequence Show only first row Show all	>Potri.003G127300.1 pacid=42784493 polypeptide=Potri.003G127300.1.p locus=Potri.003G127300 ID=Potri.003G127300.1.v4.1 annot-version=v4.1 ATGAGACTCCGAAAATTCGCGCAGATCTCAACGAGCGAAGAGGAAGAGGAAGAAGAAATGTCAAATGAACATGAAGAGGGTGAGATACTTCCCCCAGAAG AGGATGAGGATGAGGAGGCGTCGCTGGAGGATCCCAAACCGGTTGGGAAACGAGTTAGGTTTTCAGGAGAAGGAAGCGAGAAGAAAAGTCACTACAAGGT TTTCGAGTTTTCCGGAAACCGTTACACTATTGAAGATCCTGTACTTCTAGCTCCTGAAACTAAAGAGCAAAAGCCTGACATTGTAATTATCAAGGACATT ACTCAGACCATTGATGGTATGGTGATGGTCACTGGACAACTGTTTTATCACCCCGAAGATGCTAAGAAAAAGGGTGGTGGAAACTGGCAGATACGTGATA CCAGGGAGCTGTTCTACAGTACCCATCATGTTGAGGTTCCAGCAAAATGTGTAATGCACAAGTGTGTGGTGCATTTTATCCCCGCCAACAAGCAGCTTCC AGATTGCAGAAAACATCCTGGGTTTATCGTCCGGCAAATTTATGATGCTGTAGAGCAGAAGCTCTGGAAAATAACTGACAAGGACCATAACTAG
AA sequence Show only first row Show all	>Potri.003G127300.1 pacid=42784493 polypeptide=Potri.003G127300.1.p locus=Potri.003G127300 ID=Potri.003G127300.1.v4.1 annot-version=v4.1 MRLRKFAQISTSEEEEEEEMSNEHEEGEILPPEEDEDEEASLEDPKPVGKRVRFSGEGSEKKSHYKVFEFSGNRYTIEDPVLLAPETKEQKPDIVIIKDI TQTIDGMVMVTGQLFYHPEDAKKKGGGNWQIRDTRELFYSTHHVEVPAKCVMHKCVVHFIPANKQLPDCRKHPGFIVRQIYDAVEQKLWKITDKDHN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11560			bromo-adjacent homology (BAH) ...		Potri.003G127300 [exp]	0	1
AT2G02240		MEE66	maternal effect embryo arrest ...		Potri.006G266900 [exp]	2.64	0.6499
AT5G27690			Heavy metal transport/detoxifi...		Potri.013G017700 [exp]	18.54	0.6587
AT5G51350		MORE LATERAL GR...	MORE LATERAL GROWTH1, Leucine-...		Potri.006G189000 [exp]	28.86	0.6123
AT2G31160		OBO1, LSH3	ORGAN BOUNDARY 1, LIGHT SENSIT...		Potri.005G225600 [exp]	29.52	0.6461
AT5G06700		TBR	TRICHOME BIREFRINGENCE, Plant ...		Potri.016G059300 [exp]	35.49	0.6532
AT1G19220	ARF	IAA22, ARF11, A...	indole-3-acetic acid inducible...		Potri.018G145800 [exp]	36.33	0.6029	Pt-CSARF2.3
AT1G26780	MYB	LOF1, ATMYB117	LATERAL ORGAN FUSION 1, myb do...		Potri.019G040900 [exp]	38.47	0.6320
AT3G14470			NB-ARC domain-containing disea...		Potri.004G169800 [exp]	42.84	0.6344
AT5G15700			DNA/RNA polymerases superfamil...		Potri.017G105801 [exp]	43.58	0.6073
AT5G22320			Leucine-rich repeat (LRR) fami...		Potri.004G199200 [exp]	48.50	0.6207

Compare expression of checked genes

Potri.003G127300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.