Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35785 145 / 2e-43 RNA-binding (RRM/RBD/RNP motifs) family protein AT1G07350 120 / 6e-35 SR45a serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G46020 61 / 2e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 61 / 8e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G24770 63 / 1e-11 CP31, ATRBP33, ATRBP31, RBP31 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1) AT1G73530 61 / 2e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G52380 62 / 3e-11 CP33, PDE322 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) AT5G04280 61 / 4e-11 AtRZ-1c AtRZ-1c, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) AT2G37510 59 / 5e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G21440 61 / 6e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G041700 [exp] 162 / 2e-48 AT4G35785 139 / 6e-39 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.001G248100 [exp] 157 / 7e-47 AT1G07350 125 / 2e-35 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.005G105700 [exp] 150 / 3e-45 AT4G35785 158 / 4e-48 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.001G101500 [exp] 128 / 2e-37 AT4G35785 97 / 1e-25 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.011G130300 [exp] 69 / 1e-14 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 68 / 2e-14 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 63 / 3e-12 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G090200 [exp] 64 / 6e-12 AT4G24770 310 / 7e-105 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1) Potri.015G086500 [exp] 63 / 1e-11 AT4G24770 290 / 6e-97 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028776 [exp] 160 / 3e-49 AT4G35785 127 / 5e-36 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10028400 [exp] 153 / 1e-46 AT4G35785 181 / 2e-57 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10040705 [exp] 155 / 6e-46 AT1G07350 163 / 2e-46 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10041854 [exp] 150 / 3e-45 AT4G35785 179 / 6e-56 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10018202 [exp] 155 / 1e-44 AT1G07350 145 / 1e-41 serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10017507 [exp] 142 / 2e-42 AT4G35785 123 / 4e-35 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10040854 [exp] 71 / 7e-16 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10005891 [exp] 69 / 9e-14 AT3G45980 230 / 1e-76 HISTONE H2B, Histone superfamily protein (.1) Lus10003980 [exp] 62 / 6e-12 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 63 / 2e-11 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.003G130301.1 pacid=42786427 polypeptide=Potri.003G130301.1.p locus=Potri.003G130301 ID=Potri.003G130301.1.v4.1 annot-version=v4.1 ATGGCTTACTCAAGAGAAGGAAGGTCTGTTTCACCACGCAATTCGGGTTCACCTGGTAGAGGCAGGCGGTCAAGATCCTTGTCACGGTCCCGCAGAAGTC GCTCCAGGAGCAATGATTCTGGTGATGCATCTAACCCTGGAAACAACTTATATGTAACTGGATTATCAACCAGGGTCACGAGCAGTGATCTTGAGAAGTA TTTTAGCAGTGAAGGGAAGGTTTTGGAGTGCCATCTGGTGACAGATCCTCGAACTAGAGAATCTCGTGGATTTGCTTTTGTTACGATGGAAACCGTTGAG GATGCTAACCGTTGCGTCAAGTATTTGAATCGTTCGGTGCTTGAAGGACGAGTGATTACTGTGGAAAAGGCAAAAAGAAAGCGTGGTAGGACACCAACGC CTGGCAGGTATCAGGGACTGAGAGATAAGCGAGGTCATGGTCATGGCCACAGACGGTCCCGCAGCTACTCACCTCGCCGATGGGATGACAGAGATAGAGA CCCTTATTCAAGGGATCGAAGGGGAAGATCACGTTCTCCATATAGTAGGCGGGGAGATGGTTATTATGATTCGTATAAGAGGCGCAGGGATCGCTCTTTG TCAGCTGACCGCAGCCACCGCAGATAG
AA sequence Show only first row Show all	>Potri.003G130301.1 pacid=42786427 polypeptide=Potri.003G130301.1.p locus=Potri.003G130301 ID=Potri.003G130301.1.v4.1 annot-version=v4.1 MAYSREGRSVSPRNSGSPGRGRRSRSLSRSRRSRSRSNDSGDASNPGNNLYVTGLSTRVTSSDLEKYFSSEGKVLECHLVTDPRTRESRGFAFVTMETVE DANRCVKYLNRSVLEGRVITVEKAKRKRGRTPTPGRYQGLRDKRGHGHGHRRSRSYSPRRWDDRDRDPYSRDRRGRSRSPYSRRGDGYYDSYKRRRDRSL SADRSHRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Potri.003G130301 [exp]	0	1
					Potri.001G371000 [exp]	2.23	0.8871
AT4G39100		SHL1	short life, PHD finger family ...		Potri.009G121000 [exp]	4.58	0.8537	SHL1.1
AT5G37290			ARM repeat superfamily protein...		Potri.001G225300 [exp]	8.48	0.8475
AT3G29230			Tetratricopeptide repeat (TPR)...		Potri.012G140400 [exp]	10.58	0.7993
AT4G38690			PLC-like phosphodiesterases su...		Potri.009G131600 [exp]	10.86	0.7591
					Potri.010G139550 [exp]	12.00	0.8250
					Potri.010G181700 [exp]	13.78	0.8417
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.016G034875 [exp]	17.60	0.7557
AT2G27110	FAR1_related	FRS3	FAR1-related sequence 3 (.1.2....		Potri.012G097200 [exp]	19.67	0.8247
AT3G62000			S-adenosyl-L-methionine-depend...		Potri.002G183600 [exp]	19.67	0.7240

Compare expression of checked genes

Potri.003G130301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.