Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23630 284 / 8e-97 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) AT1G64090 278 / 8e-95 RTNLB3 Reticulan like protein B3 (.1.2) AT4G11220 274 / 1e-92 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) AT5G41600 268 / 9e-91 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) AT2G46170 262 / 3e-88 Reticulon family protein (.1.2) AT3G61560 251 / 7e-84 Reticulon family protein (.1.2) AT4G01230 197 / 4e-63 Reticulon family protein (.1) AT3G10260 192 / 8e-61 Reticulon family protein (.1.2.3) AT3G18260 153 / 5e-46 Reticulon family protein (.1) AT3G10915 121 / 1e-33 Reticulon family protein (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G097700 [exp] 363 / 2e-128 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.014G091200 [exp] 301 / 1e-103 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2) Potri.012G035600 [exp] 292 / 5e-100 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.015G027300 [exp] 287 / 5e-98 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.002G165400 [exp] 286 / 9e-98 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2) Potri.002G055600 [exp] 211 / 3e-68 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3) Potri.005G206800 [exp] 208 / 3e-67 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3) Potri.013G160900 [exp] 189 / 6e-60 AT4G11220 193 / 4e-61 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Potri.012G054100 [exp] 145 / 5e-43 AT3G18260 238 / 6e-80 Reticulon family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027548 [exp] 286 / 1e-97 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2) Lus10032313 [exp] 285 / 4e-97 AT4G23630 318 / 1e-109 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Lus10027546 [exp] 284 / 6e-97 AT4G11220 307 / 5e-106 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) Lus10038833 [exp] 275 / 3e-93 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) Lus10014948 [exp] 273 / 1e-92 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Lus10036405 [exp] 273 / 2e-92 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2) Lus10041080 [exp] 273 / 3e-92 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2) Lus10039307 [exp] 270 / 2e-91 AT1G64090 307 / 4e-106 Reticulan like protein B3 (.1.2) Lus10028753 [exp] 279 / 1e-87 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3) Lus10017533 [exp] 240 / 2e-79 AT1G64090 303 / 9e-104 Reticulan like protein B3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0484 [poplar] [flax] Peroxisome PF02453 [poplar] [flax] Reticulon Reticulon
Representative CDS sequence Show only first row Show all	>Potri.003G133600.1 pacid=42786407 polypeptide=Potri.003G133600.1.p locus=Potri.003G133600 ID=Potri.003G133600.1.v4.1 annot-version=v4.1 ATGGCAGAGCATGATAAGGAGGATTCAGTGATCGAGTCTGTGATGGAGAAGATCCACGACCACGATAAGTCTTCGGATTCTGATTCCGATCACGGGAAAC CGAAATCGGAATCCGATTCCCTCAAATCGAAGATTTATCGCATTTTTGGCCGTGAAAAGCCCGTCCACAAGGTTTTAGGTGGTGGAAAACCTGCTGACAT TTTCCTATGGAGGAACAAGAAGATATCAGCAGGAGTGCTTGGTGGTGCTACTGCTATATGGGTTTTGTTTGAACTGCTTGAATGCCATCTTCTCACTTTG GTTTGCTACTTCTTGATCCTCGCTCTTGCGTTACTGTTCTTGTGGTCTAATGCCTCAACCTTCATCAACAAGTCCCCACCACACATTCCAGAAGTTCGCA TTCCTGAGGAACCAGTTCTACAGATAGCTGCTGCACTTAGGATTGAGATCAATTGGGCTTTTTCTGTCCTTCGGGATATTGCATCAGGAAGGGATCTGAA GAAGTTCCTTACTGTTATTGCAGGTCTATGGGTCTTGTCTATTGTGGGGAGCTGGTGCAACTTCTTGACCTTGTTCTATATTGCTTTTGTATTGCTGTAC ACAGTACCTGTTTTCTATGAGAAGTATGAGGATCAGGTGGATGCATTTGCGGAAAAGGCAATGATTGAGATTAAGAAGCAATATGCAGTCTTCGATGCTA AAGTTCTAAGTAAGATTCCCATGGGGCCATTGAAGGGCAAGAAAAAGGATTAG
AA sequence Show only first row Show all	>Potri.003G133600.1 pacid=42786407 polypeptide=Potri.003G133600.1.p locus=Potri.003G133600 ID=Potri.003G133600.1.v4.1 annot-version=v4.1 MAEHDKEDSVIESVMEKIHDHDKSSDSDSDHGKPKSESDSLKSKIYRIFGREKPVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTL VCYFLILALALLFLWSNASTFINKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDIASGRDLKKFLTVIAGLWVLSIVGSWCNFLTLFYIAFVLLY TVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPMGPLKGKKKD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Potri.003G133600 [exp]	0	1
AT3G08890			Protein of unknown function, D...		Potri.016G125300 [exp]	2.44	0.7172
AT3G24315		ATSEC20	Sec20 family protein (.1)		Potri.010G064900 [exp]	4.58	0.7111
AT2G45140		PVA12	plant VAP homolog 12 (.1)		Potri.014G060900 [exp]	6.32	0.6592	Pt-VAP27.5
AT3G63030		MBD4	methyl-CPG-binding domain 4 (....		Potri.014G137100 [exp]	7.34	0.6627
AT1G49245			Prefoldin chaperone subunit fa...		Potri.013G072700 [exp]	8.36	0.6869
AT3G24160		PMP	putative type 1 membrane prote...		Potri.003G178400 [exp]	13.49	0.7291	Pt-PMP.2
AT3G55600			Membrane fusion protein Use1 (...		Potri.018G133700 [exp]	17.29	0.6084
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.010G070500 [exp]	19.28	0.7073
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.010G041000 [exp]	20.32	0.6795
AT2G16030			S-adenosyl-L-methionine-depend...		Potri.019G125300 [exp]	24.79	0.5809

Compare expression of checked genes

Potri.003G133600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.