Potri.003G134600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 174 / 1e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 156 / 1e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 143 / 1e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 69 / 9e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G38700 67 / 4e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 65 / 3e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 64 / 5e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 64 / 1e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142602 322 / 3e-114 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 322 / 3e-114 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 315 / 2e-111 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 315 / 3e-111 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 303 / 1e-106 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 241 / 3e-82 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 241 / 3e-82 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 201 / 1e-66 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096440 191 / 8e-63 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024715 272 / 2e-94 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 272 / 3e-94 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024714 259 / 4e-89 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 243 / 2e-82 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017539 165 / 6e-52 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028749 164 / 1e-51 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 71 / 2e-15 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 71 / 6e-15 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 69 / 8e-15 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 71 / 9e-15 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Potri.003G134600.1 pacid=42784862 polypeptide=Potri.003G134600.1.p locus=Potri.003G134600 ID=Potri.003G134600.1.v4.1 annot-version=v4.1
ATGAGAGCAAGCTGTATTCTTCTTTGTTTCTTTATGTTTCTTGCTGTATCTTCAGCCTACCCAGGCAAGAAGAAGCAGTACAAACCATGCAAGGAGTTTG
TCCTCTACTTCCATGACATTCTTTACAACGGCAAGAATGCTGCCAATGCAACATCGGCAATTGTGGCAGCACCGGAAGGGGCTAACTTAACCATCTTAGC
AGGGCAGAACCATTTTGGCAACATTATAGTTTTCGATGATCCCATTACCCTTGACAACAATCTTCATTCACCACCAGTTGGTAGGGCGCAAGGCATGTAT
ATCTATGATACCAAGAACACCTTCACTTCTTGGCTCAGCTTTACATTTGCTCTTAATAGCACACAACACCAAGGGACCATAAGTTTCATTGGAGCCGACC
CAATTTTGGTGAAGAGTAGAGATATATCTGTAGTTGGAGGCACTGGGGATTTTTTTATGCACAGGGGAATTGCAACTATAGGCACTGATGCATTTGAAGG
TGATGTGTATTTCAGACTCCACGTTGATATCAAATTCTATGAATGTTGGTAA
AA sequence
>Potri.003G134600.1 pacid=42784862 polypeptide=Potri.003G134600.1.p locus=Potri.003G134600 ID=Potri.003G134600.1.v4.1 annot-version=v4.1
MRASCILLCFFMFLAVSSAYPGKKKQYKPCKEFVLYFHDILYNGKNAANATSAIVAAPEGANLTILAGQNHFGNIIVFDDPITLDNNLHSPPVGRAQGMY
IYDTKNTFTSWLSFTFALNSTQHQGTISFIGADPILVKSRDISVVGGTGDFFMHRGIATIGTDAFEGDVYFRLHVDIKFYECW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G64160 Disease resistance-responsive ... Potri.003G134600 0 1
AT3G47780 ABCA7, ATATH6 A. THALIANA ABC2 HOMOLOG 6, AT... Potri.012G069700 3.00 0.9076 PtrAOH3,ATH2.3
AT3G47730 ABCA2, ATATH1 A. THALIANA ABC2 HOMOLOG 1, AT... Potri.012G069800 6.32 0.8941 PtrATH2,Pt-ATH1.2
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Potri.016G068600 8.24 0.9008 Pt-SYP121.1
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.013G106200 8.48 0.9007
AT1G52190 Major facilitator superfamily ... Potri.006G240000 13.63 0.8918
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Potri.007G099400 14.86 0.8668
Potri.019G016104 19.49 0.8060
AT4G12735 unknown protein Potri.001G226400 20.14 0.8845
AT5G48380 BIR1 BAK1-interacting receptor-like... Potri.010G178050 22.27 0.8835
AT4G12735 unknown protein Potri.001G226700 28.80 0.8728

Potri.003G134600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.