Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	DRR206.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G23690 177 / 2e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11210 158 / 3e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11190 152 / 7e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G11180 141 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 69 / 9e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 68 / 4e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 64 / 1e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 63 / 2e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G38700 63 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G142602 [exp] 311 / 1e-109 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096800 [exp] 311 / 1e-109 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134600 [exp] 307 / 4e-108 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.013G142501 [exp] 306 / 1e-107 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096680 [exp] 306 / 2e-107 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.013G142702 [exp] 246 / 5e-84 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G097001 [exp] 246 / 5e-84 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G096440 [exp] 209 / 1e-69 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G134400 [exp] 209 / 2e-69 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032331 [exp] 289 / 8e-101 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10024715 [exp] 288 / 3e-100 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10024714 [exp] 276 / 1e-95 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017538 [exp] 242 / 5e-82 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017539 [exp] 174 / 2e-55 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10028749 [exp] 174 / 5e-55 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 76 / 5e-17 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025804 [exp] 72 / 1e-15 AT1G22900 116 / 7e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034482 [exp] 71 / 7e-15 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 71 / 1e-14 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.003G134800.1 pacid=42786386 polypeptide=Potri.003G134800.1.p locus=Potri.003G134800 ID=Potri.003G134800.1.v4.1 annot-version=v4.1 ATGCCCTGCTTCTTTCCTCTTGAGATCATCTCTAGAAAGAAAATGAGAACTTCGGGCTTCGTTGCTATTTTCTTCATGATATTCCTTTCTGTATCCTCAG CCTATCCAGGCTGGAAGAAGCAGTACAAACCATGCAAGCAATTAGTCCTCTACTTCCATGACATTATTTACAATGGCCAGAATGCTGCTAATGCTACAGC AGCAATTGTGGCAGCACCAGAAGGTGCTAACCTAACCATCTTAGCAGGGCAGTTCCATTTTGGCAACATTGCAGTTTTTGATGATCCCATCACTCTTGAT AACAATCTTCAATCTCCACCAGTTGGTAGGGCACAAGGCATGTATATCTATGACACCAAAAACACCTTCACTGCTTGGTTAGGCTTTACATTTGTTCTTA ATAGCACAAAACACCAAGGGACGATAAATTTCATTGGAGCCGACCCAATTATGGTGAAGAGTAGAGATATATCAGTAGTTGGAGGCACTGGAGATTTTTT CATGCACAGAGGAATTGCAACGATAATGACTGATTCATTTGAAGGTGATGTGTATTTCAGGCTCCGCGTCGATGTCAAATTCTATGAATGCTGGTAA
AA sequence Show only first row Show all	>Potri.003G134800.1 pacid=42786386 polypeptide=Potri.003G134800.1.p locus=Potri.003G134800 ID=Potri.003G134800.1.v4.1 annot-version=v4.1 MPCFFPLEIISRKKMRTSGFVAIFFMIFLSVSSAYPGWKKQYKPCKQLVLYFHDIIYNGQNAANATAAIVAAPEGANLTILAGQFHFGNIAVFDDPITLD NNLQSPPVGRAQGMYIYDTKNTFTAWLGFTFVLNSTKHQGTINFIGADPIMVKSRDISVVGGTGDFFMHRGIATIMTDSFEGDVYFRLRVDVKFYECW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64160			Disease resistance-responsive ...		Potri.003G134800 [exp]	0	1	DRR206.4
AT4G39230			NmrA-like negative transcripti...		Potri.009G118300 [exp]	1.41	0.7926	PCBER2
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125651 [exp]	3.74	0.8070
AT3G07870			F-box and associated interacti...		Potri.011G037312 [exp]	13.34	0.6358
AT5G44210	AP2_ERF	AtERF9, ATERF-9	ERF DOMAIN PROTEIN- 9, erf dom...		Potri.011G057000 [exp]	15.87	0.7856
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.002G039200 [exp]	20.56	0.7243
AT1G17860			Kunitz family trypsin and prot...		Potri.010G007922 [exp]	21.44	0.7499
AT3G07870			F-box and associated interacti...		Potri.011G037200 [exp]	21.44	0.6856
					Potri.018G100100 [exp]	27.74	0.6600
AT3G19430			late embryogenesis abundant pr...		Potri.009G097400 [exp]	30.46	0.7334
AT2G26190			calmodulin-binding family prot...		Potri.006G147900 [exp]	32.80	0.7504

Compare expression of checked genes

Potri.003G134800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.