Pt-UBC.9 (Potri.003G136200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-UBC.9
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 304 / 3e-108 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G41700 302 / 1e-107 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G53300 302 / 1e-107 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 301 / 3e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT3G08690 296 / 3e-105 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 286 / 4e-101 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 278 / 9e-98 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 251 / 2e-87 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 167 / 2e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 153 / 2e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G110200 307 / 2e-109 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.001G094900 306 / 5e-109 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.016G138900 306 / 8e-109 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 305 / 1e-108 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.012G033000 305 / 1e-108 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 305 / 1e-108 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.011G168200 296 / 3e-105 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 296 / 3e-105 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 291 / 3e-103 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039323 305 / 2e-108 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 305 / 2e-108 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 303 / 1e-107 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 303 / 1e-107 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 302 / 2e-107 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 301 / 3e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 301 / 3e-107 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10033937 300 / 2e-106 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10021385 298 / 7e-106 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027846 288 / 8e-102 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Potri.003G136200.3 pacid=42785319 polypeptide=Potri.003G136200.3.p locus=Potri.003G136200 ID=Potri.003G136200.3.v4.1 annot-version=v4.1
ATGGCATCGAAACGGATCTTGAAAGAACTCAAGGATCTCCAGAAAGATCCTCCTACTTCTTGCAGCGCAGGCCCTGTTGCTGAAGACATGTTCCATTGGC
AAGCTACGATTATGGGTCCTGCTGATAGTCCATATGCAGGGGGGGTCTTTCTGGTTACAATTCATTTTCCTCCAGACTATCCATTTAAACCTCCTAAGGT
TGCTTTCAGGACAAAGGTCTTTCACCCAAATATCAACAGCAATGGTAGCATTTGCCTTGATATCTTGAAGGAGCAGTGGAGCCCTGCCCTCACTATATCT
AAGGTGTTGCTTTCGATTTGTTCTTTATTGACGGATCCAAATCCCGATGACCCTCTGGTGCCTGAGATTGCCCACATGTACAAGACTGACAGGAGCAAAT
ACGAGACAACTGCAAGGAGCTGGACCCAGAAGTATGCAATGGGTTGA
AA sequence
>Potri.003G136200.3 pacid=42785319 polypeptide=Potri.003G136200.3.p locus=Potri.003G136200 ID=Potri.003G136200.3.v4.1 annot-version=v4.1
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Potri.003G136200 0 1 Pt-UBC.9
AT2G25280 unknown protein Potri.018G023700 1.73 0.8248
AT1G19910 AVA-2PE, ATVHA-... VACUOLAR-TYPE H+ ATPASE C2, AT... Potri.002G082700 12.36 0.8057
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Potri.008G051700 14.69 0.7881 Pt-RAB1.11
AT1G19130 unknown protein Potri.006G140000 18.16 0.7945
AT3G63120 CYCP1;1 cyclin p1;1 (.1) Potri.005G209800 22.80 0.7696
AT4G02580 NADH-ubiquinone oxidoreductase... Potri.002G045200 24.39 0.7194
AT3G49870 ATARLA1C ADP-ribosylation factor-like A... Potri.001G293100 27.11 0.7766
AT3G51610 NPU NO PRIMEXINE AND PLASMA MEMBRA... Potri.016G134700 28.28 0.7702
AT3G15290 3-hydroxyacyl-CoA dehydrogenas... Potri.001G398600 29.66 0.7707
AT1G60430 ARPC3 actin-related protein C3 (.1.2... Potri.006G063400 33.94 0.7941

Potri.003G136200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.