Plant FIBer expression Database

Potri.003G136500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23760 89 / 1e-24 Cox19-like CHCH family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G094750
[exp]
86 / 4e-24 AT4G23760 63 / 9e-15 Cox19-like CHCH family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032354
[exp]
69 / 7e-17 AT4G23760 66 / 6e-15 Cox19-like CHCH family protein (.1)
PFAM info
Representative CDS sequence
>Potri.003G136500.1 pacid=42786358 polypeptide=Potri.003G136500.1.p locus=Potri.003G136500 ID=Potri.003G136500.1.v4.1 annot-version=v4.1
ATGGAGGAAGCGCGTGCAAAGCCCGTGTGTGCAGAGGAAGCACTGAATCTGTTAAACTGTGTTGCCCAATCGCCTTATGATCAAGACAAATGTGTCCGTC
TCTTGCAAACTTTGAGAGAGTGTGTTCTCAATAAGAAAGTGAAGAAGTTCTCGCTAGCTGATCAGGACCAACAGGAAGCAAATTCAGTCTTCAAGAAATC
TTAA
AA sequence
>Potri.003G136500.1 pacid=42786358 polypeptide=Potri.003G136500.1.p locus=Potri.003G136500 ID=Potri.003G136500.1.v4.1 annot-version=v4.1
MEEARAKPVCAEEALNLLNCVAQSPYDQDKCVRLLQTLRECVLNKKVKKFSLADQDQQEANSVFKKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G23760 Cox19-like CHCH family protein... Potri.003G136500
[exp]
0 1
AT5G52370 unknown protein Potri.001G246800
[exp]
8.71 0.7558
AT1G06200 Peptidase S24/S26A/S26B/S26C f... Potri.002G037900
[exp]
9.79 0.7402
AT3G05810 unknown protein Potri.013G007600
[exp]
10.81 0.7386
AT5G12320 ankyrin repeat family protein ... Potri.001G276100
[exp]
14.00 0.6998
AT3G19508 unknown protein Potri.009G094200
[exp]
23.74 0.6877
AT1G24050 RNA-processing, Lsm domain (.1... Potri.008G146200
[exp]
27.22 0.6702
AT4G16710 glycosyltransferase family pro... Potri.005G036500
[exp]
27.49 0.6359
AT3G28370 unknown protein Potri.001G350100
[exp]
30.65 0.5507
AT2G29960 CYP19-4, ATCYP5... CYCLOPHILIN 19-4, ARABIDOPSIS ... Potri.009G046500
[exp]
39.24 0.6364 Pt-CYP5.3
AT3G06700 Ribosomal L29e protein family ... Potri.008G107700
[exp]
41.71 0.6803

Potri.003G136500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.