Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61660 57 / 1e-11 unknown protein AT2G46375 40 / 2e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G094000 [exp] 144 / 4e-46 AT3G61660 55 / 1e-10 unknown protein Potri.002G168300 [exp] 57 / 2e-11 AT3G61660 57 / 3e-11 unknown protein Potri.014G095600 [exp] 53 / 6e-10 AT3G61660 65 / 5e-14 unknown protein Potri.001G093500 [exp] 39 / 0.0002 AT5G41810 135 / 1e-39 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032366 [exp] 65 / 2e-14 AT3G61660 61 / 1e-12 unknown protein Lus10033949 [exp] 59 / 4e-12 AT3G61660 59 / 5e-12 unknown protein Lus10005152 [exp] 54 / 2e-10 AT3G61660 58 / 1e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G137600.2 pacid=42786590 polypeptide=Potri.003G137600.2.p locus=Potri.003G137600 ID=Potri.003G137600.2.v4.1 annot-version=v4.1 ATGGAGGAGAAAAGAGAGGCAGGGCGAGCAGCTGTTAACGTGTGGGACTGTGGGAGTCCCTTGTATGATTCATATGAAATAGCTTCACTTGGTCATGTCA TTGACAGGCACAGCTTGGCCTTGCCGACTCCATTTGGATCGAGAAAGGAAGGCAGGCATGTCATCCAGTATTCAAGCATGCCAAGAGATCAAGAAAAGGG TCTTGAGGTCAAGCAGGAAGGAGCTTTATTTAAGATAATAAGGGTTTTCTCCTGGAAGAGAACAACGATCAAGGAAAGGAGTGATAAAGGCATCTACAAA ACCTGGTGA
AA sequence Show only first row Show all	>Potri.003G137600.2 pacid=42786590 polypeptide=Potri.003G137600.2.p locus=Potri.003G137600 ID=Potri.003G137600.2.v4.1 annot-version=v4.1 MEEKREAGRAAVNVWDCGSPLYDSYEIASLGHVIDRHSLALPTPFGSRKEGRHVIQYSSMPRDQEKGLEVKQEGALFKIIRVFSWKRTTIKERSDKGIYK TW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61660			unknown protein		Potri.003G137600 [exp]	0	1
AT4G08850			Leucine-rich repeat receptor-l...		Potri.019G099200 [exp]	1.41	0.8939
AT2G13840			Polymerase/histidinol phosphat...		Potri.001G206400 [exp]	14.96	0.8369
AT5G17280			unknown protein		Potri.007G017200 [exp]	18.86	0.7336
AT1G32730			unknown protein		Potri.003G085901 [exp]	19.44	0.7899
AT1G78420			RING/U-box superfamily protein...		Potri.011G096000 [exp]	19.89	0.7970
AT1G11340			S-locus lectin protein kinase ...		Potri.004G028300 [exp]	34.02	0.8225
AT5G18260			RING/U-box superfamily protein...		Potri.006G180600 [exp]	52.85	0.7238
AT2G20500			unknown protein		Potri.005G224200 [exp]	66.94	0.7142
AT3G12290			Amino acid dehydrogenase famil...		Potri.011G098600 [exp]	73.31	0.7244
AT3G13550		EMB144, COP10, ...	FUSCA 9, EMBRYO DEFECTIVE 144,...		Potri.001G089300 [exp]	87.06	0.7445

Compare expression of checked genes

Potri.003G137600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.