Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53160 297 / 5e-104 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT1G01360 288 / 1e-100 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G27920 268 / 7e-93 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT4G01026 269 / 1e-92 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT5G05440 181 / 5e-58 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G38310 174 / 3e-55 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 170 / 1e-53 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT2G26040 158 / 2e-49 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G17870 155 / 3e-48 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G45860 143 / 7e-44 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G092500 [exp] 372 / 1e-133 AT5G53160 296 / 7e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.012G000800 [exp] 314 / 8e-111 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.015G020500 [exp] 313 / 2e-110 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.014G097100 [exp] 309 / 5e-109 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.002G169400 [exp] 307 / 3e-108 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.016G125400 [exp] 186 / 1e-59 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 185 / 2e-59 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.001G142500 [exp] 174 / 3e-55 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G183900 [exp] 172 / 1e-54 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001059 [exp] 321 / 3e-113 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10039335 [exp] 312 / 8e-110 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10038818 [exp] 295 / 1e-102 AT5G53160 287 / 1e-99 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10014929 [exp] 290 / 8e-101 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 268 / 8e-93 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Lus10014239 [exp] 184 / 3e-59 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 183 / 7e-58 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 177 / 4e-56 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 161 / 4e-51 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 157 / 7e-49 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF10604 [poplar] [flax] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Potri.003G139200.1 pacid=42784627 polypeptide=Potri.003G139200.1.p locus=Potri.003G139200 ID=Potri.003G139200.1.v4.1 annot-version=v4.1 ATGGTGACAAATGATTATGTGACGATTGCGAGTGGAAAGATGGAAGATGAGTTCATAAAACGACATCATAAACATGATGTTAAAGAACATCAGTGTAGTT CTTCTCTTGTCAAGCACATCAAGGCTCCTGTTCCTCTTGTGTGGTCTCTGGTGAGGAGATTTGATCAACCACAGAAGTATAAGCCATTTGTAAGCAGGTG TGTTGTGCAGGGAGACCTTCAGATTGGAAGTGTTAGAGAGGTGAATGTTAAGTCCGGACTTCCAGCTACGACTAGTACTGAACGATTGGAGCTATTAGAC GATGAGGAGCACATTTTTAGTATGAAGATTGTTGGTGGAGATCATAGACTTAAGAACTATTTGTCCACTGTTACTGTTCATCCAGAGGTCATTGATGGGA GACCTGGTACATTGGTGATCGAGTCATTTATTGTGGATGTGCCTGATGGAAATACCAAGGATGAAACATGTTACTTTGTTGAGGCCCTGATCAAGTGCAA CCTGAAGTCACTGGCTGATGTGTCAGAGCGTTTGGCGGTCCAAGACCGGACAGAACCCATTGACAGAATGTAA
AA sequence Show only first row Show all	>Potri.003G139200.1 pacid=42784627 polypeptide=Potri.003G139200.1.p locus=Potri.003G139200 ID=Potri.003G139200.1.v4.1 annot-version=v4.1 MVTNDYVTIASGKMEDEFIKRHHKHDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCVVQGDLQIGSVREVNVKSGLPATTSTERLELLD DEEHIFSMKIVGGDHRLKNYLSTVTVHPEVIDGRPGTLVIESFIVDVPDGNTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPIDRM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Potri.003G139200 [exp]	0	1
AT4G20270		BAM3	BARELY ANY MERISTEM 3, Leucine...		Potri.001G073600 [exp]	2.64	0.8957
AT3G27200			Cupredoxin superfamily protein...		Potri.016G015200 [exp]	3.16	0.8320
AT3G52490			Double Clp-N motif-containing ...		Potri.010G241600 [exp]	5.65	0.8764
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.010G071850 [exp]	7.07	0.8568
AT5G65700		BAM1	BARELY ANY MERISTEM 1, Leucine...		Potri.004G223900 [exp]	13.11	0.8653
AT2G37590	DOF	AtDof2. 4, ATDO...	DNA binding with one finger 2....		Potri.010G205400 [exp]	14.07	0.8531
AT5G44170			S-adenosyl-L-methionine-depend...		Potri.001G148200 [exp]	15.42	0.8520
AT4G35020		ROP6, ARAC3, RH...	RHO-RELATED PROTEIN FROM PLANT...		Potri.004G174900 [exp]	15.49	0.7944	RAC4.3
AT2G27770			Plant protein of unknown funct...		Potri.004G187600 [exp]	16.00	0.8014
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Potri.006G223500 [exp]	16.97	0.7783

Compare expression of checked genes

Potri.003G139200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.